Gene Information

Name : ECNA114_4745 (ECNA114_4745)
Accession : YP_006141868.1
Strain : Escherichia coli NA114
Genome accession: NC_017644
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4892465 - 4892701 bp
Length : 237 bp
Strand : -
Note : -

DNA sequence :
ATGTTGACCTCAATAACAGGCCACGACAGTGTATTGCTGCGTGCCGACGATCCCCTGATCGACATGAACTACATCACCAG
TTTCACTGGCATGACAGATAAATGGTTTTACAAGCTGATCAGTGAAGGTCATTTCCCTAAACCCATCAAACTGGGGCGCA
GCAGCCGCTGGTACAAAAGTGAAGTGGAGCAGTGGATGCAGCAACGAATCGAGGAATCCCGGGGGGCAGCAGCATGA

Protein sequence :
MLTSITGHDSVLLRADDPLIDMNYITSFTGMTDKWFYKLISEGHFPKPIKLGRSSRWYKSEVEQWMQQRIEESRGAAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-30 97
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 3e-30 97
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 1e-23 91
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 1e-23 91
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 2e-17 70
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 1e-17 70
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 1e-17 70
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 6e-18 70
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 2e-17 70

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECNA114_4745 YP_006141868.1 hypothetical protein VFG1480 Protein 1e-30 97
ECNA114_4745 YP_006141868.1 hypothetical protein VFG0651 Protein 5e-18 70