Gene Information

Name : ECNA114_4506 (ECNA114_4506)
Accession : YP_006141629.1
Strain : Escherichia coli NA114
Genome accession: NC_017644
Putative virulence/resistance : Unknown
Product : Putative transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4657941 - 4658237 bp
Length : 297 bp
Strand : +
Note : -

DNA sequence :
ATGCGTAAATCCTTCAACGGACTGGGAGAACAGGTACAACATGTGCTGAATGATAATCCCTTCTCCGGTCACCTGTTTAT
CTTCCGTGGCCGACGGGGTGACACCGTCAAAATTCTTTGGGCTGATGCTGATGGTCTGTGCCTGTTCACCAAACGCCTGG
AGGAAGGCCAGTTTATCTGGCCTGCGGTACGTGACGGCAAGGTATCCATTACCCGCTCGCAACTGGCAATGCTCCTCGAT
AAGCTGGACTGGCGTCAGCCAAAAACATCCAGCCGTAACTCACTGACAATGTTGTAA

Protein sequence :
MRKSFNGLGEQVQHVLNDNPFSGHLFIFRGRRGDTVKILWADADGLCLFTKRLEEGQFIWPAVRDGKVSITRSQLAMLLD
KLDWRQPKTSSRNSLTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-39 96
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-39 96
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 5e-40 94
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 5e-40 94
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-40 93
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-27 65
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-27 65
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 8e-27 65
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 9e-27 64
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-27 64
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 9e-27 64
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-27 64
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-27 64
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-27 64
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-27 64
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 6e-27 64
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 6e-27 64
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 6e-27 64
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-32 63
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-32 63
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-31 62
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-19 62
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-28 58
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-28 58
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-21 52

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECNA114_4506 YP_006141629.1 Putative transposase VFG1737 Protein 2e-40 93
ECNA114_4506 YP_006141629.1 Putative transposase VFG1052 Protein 1e-27 65
ECNA114_4506 YP_006141629.1 Putative transposase VFG1698 Protein 2e-27 65
ECNA114_4506 YP_006141629.1 Putative transposase VFG1709 Protein 2e-27 64
ECNA114_4506 YP_006141629.1 Putative transposase VFG0792 Protein 2e-27 64
ECNA114_4506 YP_006141629.1 Putative transposase VFG1665 Protein 7e-32 62
ECNA114_4506 YP_006141629.1 Putative transposase VFG1517 Protein 2e-19 62