Gene Information

Name : UMNK88_5213 (UMNK88_5213)
Accession : YP_006136842.1
Strain : Escherichia coli UMNK88
Genome accession: NC_017641
Putative virulence/resistance : Unknown
Product : phage integrase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5084654 - 5085568 bp
Length : 915 bp
Strand : +
Note : -

DNA sequence :
ATGGCTCTGAGTGATGTGAAGGTTCGTTCGGCTAAGCCTGAAGCAAAAGCCTATAAGCTGACCGACGGTGAAGGCATGGT
TTTGCTGGTTCACCCTAACGGCTCCAAATACTGGCGGCTACGTTATCGCTTTGGCGGTAAAGAGAAGATGCTGGCATTGG
GGAAATACCCCGAAGTGTCGTTGGCGGATGCCAGGGCACGCCGGGATGAGGCTCGTAAGCTTTTAGCTAATGGTGTCGAT
CCCAGTGAAAACAAGAAAGCTGTTAAGGTAGAACAGGAACAAGAGGCGATAACGTTTGAAGTAGTCGCCAGAGACTGGCA
CGCCAGCAATCAGAAGTGGTCGGCATCGCATAGCGCTCGTGTTTTGAAAAGTCTGGAGGATAATCTCTTTACTGCTATCG
GTAAGCGGAACATTGCGGAACTGAAGACGCGGGATCTTCTTGTACCCATTAAAGCAGTCGAGTCATCCGGGCGGCTCGAA
GTTGCCGCCCGTTTACAGCAGCGTACTACCGCGATTATGCGCTTTGCCGTTCAGAGCGGCTTAATCGACTACAACCCCGC
GCAAGAGATTGCAGGTGCGGTTGCTACGGCGAAAAGACAGCACCGTGCAGCTCTTGAACTGAACCGTATACCTGAATTAC
TTCATCGCATAGATCACTATTCTGGCAGACCGTTAACTCGACTGGCGGTTGAACTCACTTTATTGGTTTTCATCCGTTCG
AGCGAGCTGCATTTTGCCCGCTGGTCAGAAGTAGATTTTGAAACGGCTATGTGGACAATCCCAGGTGAGCGTGAGCAACT
GGAAGGAGTCAAGCATTCTCAGCGTGGCTCGAAGATGCGGACACCACACCTTGTACCTTTGTCGCGGCAGGCCCTAAGTA
TTTTGGAAAAGATCAAAAGCATGAGCGGAAATTGA

Protein sequence :
MALSDVKVRSAKPEAKAYKLTDGEGMVLLVHPNGSKYWRLRYRFGGKEKMLALGKYPEVSLADARARRDEARKLLANGVD
PSENKKAVKVEQEQEAITFEVVARDWHASNQKWSASHSARVLKSLEDNLFTAIGKRNIAELKTRDLLVPIKAVESSGRLE
VAARLQQRTTAIMRFAVQSGLIDYNPAQEIAGAVATAKRQHRAALELNRIPELLHRIDHYSGRPLTRLAVELTLLVFIRS
SELHFARWSEVDFETAMWTIPGEREQLEGVKHSQRGSKMRTPHLVPLSRQALSILEKIKSMSGN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 2e-97 76
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 6e-92 65
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 9e-94 64
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 2e-93 64
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 7e-94 64
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 7e-94 64
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 3e-93 64
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 9e-94 64
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 2e-93 64
int AAL51003.1 CP4-like integrase Not tested LEE Protein 6e-94 64
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 2e-93 64
int AAK16198.1 Int Not tested PAI-I AL862 Protein 6e-94 64
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 6e-94 64
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 1e-93 64
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 9e-93 64
int AAL51028.1 CP4-like integrase Not tested LEE Protein 1e-93 64
int-phe AAL60261.1 Int-phe Not tested LEE Protein 1e-93 64
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 1e-93 64
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 2e-93 64
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 4e-93 63
int AAK00456.1 Int Not tested SHI-1 Protein 3e-84 63
int CAC81896.1 integrase Not tested LEE II Protein 6e-84 63
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 3e-80 56
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 3e-80 56
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 3e-74 53
int NP_458759.1 bacteriophage integrase Not tested SPI-7 Protein 6e-68 50
int NP_807963.1 bacteriophage integrase Not tested SPI-7 Protein 6e-68 50
int CAA08754.1 integrase Not tested HPI Protein 1e-62 49
int CAB59974.1 integrase Not tested HPI Protein 3e-63 49
int YP_002346908.1 integrase Not tested HPI Protein 2e-62 49
y2393 NP_669700.1 prophage integrase Not tested HPI Protein 2e-62 49
int2 NP_993013.1 integrase Not tested HPI Protein 2e-62 49
int CAA21384.1 - Not tested HPI Protein 2e-62 49
APECO1_1051 YP_853069.1 phage integrase Not tested PAI IV APEC-O1 Protein 2e-43 49
unnamed AAD17660.1 unknown Not tested HPI Protein 2e-60 48
int AAD44730.1 Int Not tested SHI-2 Protein 8e-63 45
int CAC39282.1 integrase Not tested LPA Protein 1e-63 45
aec33 AAW51716.1 Int Not tested AGI-3 Protein 1e-63 45
int ACU09430.1 integrase Not tested LEE Protein 5e-61 44
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 7e-61 44
ECs4534 NP_312561.1 integrase Not tested LEE Protein 7e-61 44
int AAC31482.1 CP4-like integrase Not tested LEE Protein 5e-61 44
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 8e-62 44
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 1e-61 44
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 1e-61 44
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 9e-54 42
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 2e-53 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UMNK88_5213 YP_006136842.1 phage integrase VFG1536 Protein 1e-97 76
UMNK88_5213 YP_006136842.1 phage integrase VFG0626 Protein 3e-94 64
UMNK88_5213 YP_006136842.1 phage integrase VFG1693 Protein 8e-94 64
UMNK88_5213 YP_006136842.1 phage integrase VFG0783 Protein 3e-61 44
UMNK88_5213 YP_006136842.1 phage integrase VFG0598 Protein 4e-62 44