Gene Information

Name : UMNK88_3679 (UMNK88_3679)
Accession : YP_006135378.1
Strain : Escherichia coli UMNK88
Genome accession: NC_017641
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3550641 - 3550937 bp
Length : 297 bp
Strand : -
Note : putative transposase

DNA sequence :
ATGCGTAAATCCTTCAACGGGCTGGAAGAACAGGTACAATATGTGCTGGATGAGAACCCCTTCTCAGGTCACCTGTTTAT
CTTTCGTGGCCGACGGGGTGACACTGTTAAAATACTCAGGGCCGATGCTGATGGTCTGTGCCTGTTCACCAAACGCCTGG
AGGAAGGCCAGTTTATCTGGCCTGCGGTGCGTGACGGTAAGGTATCCATTACCCGCTCGCAACTGGCAATGCTCCTCGAT
AAGCTGGACTGGCGTCAGCCAAAAACATTCCGCCTTAACTCACTGACAATGTTGTAA

Protein sequence :
MRKSFNGLEEQVQYVLDENPFSGHLFIFRGRRGDTVKILRADADGLCLFTKRLEEGQFIWPAVRDGKVSITRSQLAMLLD
KLDWRQPKTFRLNSLTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-39 94
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-39 94
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-38 92
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-38 92
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-39 91
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-29 66
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-29 66
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 4e-29 65
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-27 64
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 6e-27 63
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-27 63
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-27 63
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-27 63
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-27 63
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-27 63
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-27 63
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-27 63
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-27 63
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-27 63
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-27 63
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 6e-27 63
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 5e-26 61
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 5e-26 61
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 8e-21 55

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UMNK88_3679 YP_006135378.1 hypothetical protein VFG1737 Protein 9e-40 91
UMNK88_3679 YP_006135378.1 hypothetical protein VFG1665 Protein 2e-29 65
UMNK88_3679 YP_006135378.1 hypothetical protein VFG1052 Protein 8e-28 64
UMNK88_3679 YP_006135378.1 hypothetical protein VFG1698 Protein 1e-27 63
UMNK88_3679 YP_006135378.1 hypothetical protein VFG1709 Protein 1e-27 63
UMNK88_3679 YP_006135378.1 hypothetical protein VFG0792 Protein 1e-27 63