Gene Information

Name : UMNK88_1952 (UMNK88_1952)
Accession : YP_006133710.1
Strain : Escherichia coli UMNK88
Genome accession: NC_017641
Putative virulence/resistance : Resistance
Product : transcriptional defense system activation protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1883519 - 1883902 bp
Length : 384 bp
Strand : +
Note : -

DNA sequence : 
ATGTCCAGACGCAATACTGACGCTATTACCATTCATAGCATTTTGGACTGGATCGAGGACAACCTGGAATCGCCACTGTC
ACTGGAGAAAGTGTCAGAGCGTTCAGGTTACTCTAAATGGCACCTGCAACGGATGTTTAAAAAAGAAACCGGTCATTCAT
TAGGCCAATACATCCGCAGCCGTAAGATGACGGAAATCGCGCAAAAGCTGAAGGAAAGTAACGAGCCGATACTCTATCTG
GCAGAACGATATGGCTTCGAGTCGCAACAAACTCTGACCCGAACCTTCAAAAATTACTTTGATGTTCCGCCGCATAAATA
CCGGATGACCAATATGCAGGGCGAATCGCGCTTTTTACATCCATTAAATCATTACAACAGCTAG

Protein sequence : 
MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 3e-21 43
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 3e-21 43
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein BAC0560 Protein 9e-57 100
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein NC_002695.1.917339.p Protein 9e-57 100
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein CP000034.1.gene1596. Protein 1e-56 99
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein CP001138.1.gene1637. Protein 2e-53 96
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein CP001918.1.gene2033. Protein 1e-52 93
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein CP000647.1.gene1624. Protein 2e-52 93
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein CP001138.1.gene612.p Protein 6e-23 43
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein NC_010558.1.6276025. Protein 2e-21 43
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein CP000034.1.gene4505. Protein 3e-19 42
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein BAC0371 Protein 1e-19 42
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein CP001138.1.gene4488. Protein 4e-20 42
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein NC_002695.1.914293.p Protein 1e-19 42
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein CP001918.1.gene327.p Protein 3e-20 42
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein CP000647.1.gene4499. Protein 8e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein VFG1038 Protein 1e-21 43
UMNK88_1952 YP_006133710.1 transcriptional defense system activation protein VFG0585 Protein 4e-20 42