Gene Information

Name : UMNK88_1289 (UMNK88_1289)
Accession : YP_006133066.1
Strain : Escherichia coli UMNK88
Genome accession: NC_017641
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1276170 - 1276547 bp
Length : 378 bp
Strand : +
Note : putative toxin of the YeeV-YeeU toxin-antitoxin system

DNA sequence :
ATGAAAACATTACCTGTATTACCCGGGCAGGCGGCCAGTTCTCGCCCGTCTCCTGTTGAAATCTGGCAGATACTGCTGTC
CCGACTGCTGGACCAGCACTACGGCCTCACACTGAATGACACACCGTTTGCCGATGAACGTGTGATTGAGCAGCATATTG
AAGCTGGCATTTCACTGTGTGATGCGGTGAACTTTCTCGTGGAAAAATACGCACTGGTGCGTACCGACCAGCCGGGATTC
AGCGCCTGTACCCACTCTCAGTTAATAAACAGCATCGATATCCTCCGGGCCCGCCGGGCGACAGGCCTGATGACCCGCGA
CAATTACAGAACGGTAAATAACATTACCTTGGGTAAACATCCGGGGGCGAAACAATGA

Protein sequence :
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-47 89
unnamed AAL57575.1 unknown Not tested LEE Protein 4e-47 89
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 8e-48 89
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 1e-46 88
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 7e-47 88
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 7e-47 88
unnamed AAC31486.1 L0007 Not tested LEE Protein 2e-47 88
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 1e-45 88
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 2e-47 88
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 6e-46 88
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 3e-47 88
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 1e-47 88
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 3e-47 88
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 2e-46 87
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 3e-45 86
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 5e-45 86
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 5e-45 86
unnamed AAL08478.1 unknown Not tested SRL Protein 3e-45 85
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 9e-45 85
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 5e-44 85
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 2e-44 84
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-44 83

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UMNK88_1289 YP_006133066.1 hypothetical protein VFG0786 Protein 8e-48 88
UMNK88_1289 YP_006133066.1 hypothetical protein VFG1682 Protein 5e-47 88
UMNK88_1289 YP_006133066.1 hypothetical protein VFG1620 Protein 5e-48 88
UMNK88_1289 YP_006133066.1 hypothetical protein VFG1530 Protein 4e-46 88
UMNK88_1289 YP_006133066.1 hypothetical protein VFG0663 Protein 1e-45 86
UMNK88_1289 YP_006133066.1 hypothetical protein VFG1069 Protein 1e-45 85