Gene Information

Name : UMNK88_1217 (UMNK88_1217)
Accession : YP_006132996.1
Strain : Escherichia coli UMNK88
Genome accession: NC_017641
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1218387 - 1218683 bp
Length : 297 bp
Strand : +
Note : -

DNA sequence :
ATGCGTAAATCCTTCAACGGTCTGGGAGAACAGGTACAACATGTGCTGGATGAGAACCCCTTCTCCGGTCACCTGTTTAT
CTTTCGCGGCCGACGGGGTGACACGATTAAAATTCTGTGGGCTGATGCTGATGGTCTGTGCCTGTTCACCAAACGTCTGG
AGGAAGGCCAGTTTATCTGGCCTGCGGTGCGTGACGGTAAGGTATCCATTACCCGCTCGCAGCTGGCAATGCTCCTCGAT
AAACTGGACTGGCGTCAGCCCAAAACATCCCGCCTTAATGCACTGACAATGTTGTAA

Protein sequence :
MRKSFNGLGEQVQHVLDENPFSGHLFIFRGRRGDTIKILWADADGLCLFTKRLEEGQFIWPAVRDGKVSITRSQLAMLLD
KLDWRQPKTSRLNALTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 9e-42 100
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 9e-42 100
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-41 97
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-40 96
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-40 96
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 8e-31 67
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 8e-31 67
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-30 66
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-27 63
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-27 62
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-27 62
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-27 62
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-27 62
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-27 62
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-27 62
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-27 62
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-27 62
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-27 62
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-27 62
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-27 62
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-27 62
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 7e-19 60
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-27 59
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-27 59
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-21 56

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UMNK88_1217 YP_006132996.1 hypothetical protein VFG1737 Protein 4e-42 97
UMNK88_1217 YP_006132996.1 hypothetical protein VFG1665 Protein 1e-30 66
UMNK88_1217 YP_006132996.1 hypothetical protein VFG1052 Protein 5e-28 63
UMNK88_1217 YP_006132996.1 hypothetical protein VFG1698 Protein 8e-28 62
UMNK88_1217 YP_006132996.1 hypothetical protein VFG1709 Protein 7e-28 62
UMNK88_1217 YP_006132996.1 hypothetical protein VFG0792 Protein 7e-28 62
UMNK88_1217 YP_006132996.1 hypothetical protein VFG1517 Protein 3e-19 60