Gene Information

Name : UMNK88_pEnt38 (UMNK88_pEnt38)
Accession : YP_006131771.1
Strain :
Genome accession: NC_017640
Putative virulence/resistance : Unknown
Product : putative transposase subunit
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 21452 - 21790 bp
Length : 339 bp
Strand : +
Note : component of IS911

DNA sequence :
GTGATATGCTCACCTCAGAACAACACAGGTGCTCCAATGAAAAAAAGAAATTTCAGCGCAGAGTTTAAACGCGAATCCGC
TCAACTGGTTGTTGACCAGAACTACACGGTGGCAGATGCCGCCAAAGCTATGGATGTCGGCCTTTCCACAATGACAAGAT
GGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAATACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGT
GAGCTGAGGAAAAAGCTACAACGCATTGAAATGGAGAATGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTC
CCTGAACAGTTCTCGATAA

Protein sequence :
MICSPQNNTGAPMKKRNFSAEFKRESAQLVVDQNYTVADAAKAMDVGLSTMTRWVKQLRDERQGKIPKASPITPEQIEIR
ELRKKLQRIEMENEILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 4e-41 98
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 4e-41 98
api80 CAF28554.1 putative transposase Not tested YAPI Protein 8e-35 95
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-39 93
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-34 72
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-34 72
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-34 72
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-34 72
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-34 72
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-34 72
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-34 72
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-34 72
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-29 72
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 1e-22 60
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 7e-26 59
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 5e-26 59
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 5e-25 58
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 5e-25 58
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-25 58
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-22 55
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 3e-20 45
tnpA CAB61575.1 transposase A Not tested HPI Protein 9e-20 44
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 4e-12 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UMNK88_pEnt38 YP_006131771.1 putative transposase subunit VFG1485 Protein 2e-41 98
UMNK88_pEnt38 YP_006131771.1 putative transposase subunit VFG1123 Protein 2e-34 72
UMNK88_pEnt38 YP_006131771.1 putative transposase subunit VFG1553 Protein 5e-30 72
UMNK88_pEnt38 YP_006131771.1 putative transposase subunit VFG0784 Protein 2e-25 58
UMNK88_pEnt38 YP_006131771.1 putative transposase subunit VFG1566 Protein 2e-12 42