Gene Information

Name : yafW (ECDH1ME8569_0233)
Accession : YP_006127634.1
Strain : Escherichia coli DH1
Genome accession: NC_017638
Putative virulence/resistance : Virulence
Product : CP4-6 prophage; antitoxin of the YkfI-YafW toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 262915 - 263232 bp
Length : 318 bp
Strand : -
Note : -

DNA sequence :
ATGAGCAACCCTACCAGGGGCCTGCAGCGGGAGATTACACTGCGCCTGGGAGCCCGTCTGGTGCAGGAAGGCAACCGACT
GCATTATCTGGCTGACCGGGCCAGCATCACCGGCAAGTTCAGTGACATCGAATGCCGGAAGCTGGATGAAACATTCCCGC
ACTTTATCCTCCAGATGGAATCGATGCTGACCACCGGTGAACTCAGCCCCCACCATGCCCACTGCGTTACCCTGTACCAC
AACGATTTAACCTGCGAAGCCGACACCCTTGGCAGTTGCGGCTACGTATACATCGCCATTTACCCCACTCAGCGTTAA

Protein sequence :
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 5e-27 65
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 5e-27 65
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 3e-27 65
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 1e-26 64
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 9e-26 64
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 2e-26 63
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 6e-26 63
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 2e-24 63
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 3e-25 63
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-25 63
Z1220 NP_286755.1 structural protein Not tested TAI Protein 2e-24 62
Z1658 NP_287161.1 structural protein Not tested TAI Protein 2e-24 62
unnamed AAL08477.1 unknown Not tested SRL Protein 1e-24 60

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yafW YP_006127634.1 CP4-6 prophage; antitoxin of the YkfI-YafW toxin-antitoxin system VFG0662 Protein 2e-27 65
yafW YP_006127634.1 CP4-6 prophage; antitoxin of the YkfI-YafW toxin-antitoxin system VFG1619 Protein 6e-27 64
yafW YP_006127634.1 CP4-6 prophage; antitoxin of the YkfI-YafW toxin-antitoxin system VFG1681 Protein 7e-25 63
yafW YP_006127634.1 CP4-6 prophage; antitoxin of the YkfI-YafW toxin-antitoxin system VFG1068 Protein 4e-25 60