Gene Information

Name : qseB (ECW_m3292)
Accession : YP_006125905.1
Strain : Escherichia coli W
Genome accession: NC_017635
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system with QseC
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3383897 - 3384556 bp
Length : 660 bp
Strand : +
Note : -

DNA sequence :
ATGCGAATTTTACTGATAGAAGATGACATGCTGATTGGCGACGGCATCAAAACGGGCCTTAGTAAAATGGGTTTTAGCGT
CGACTGGTTTACACAAGGTCGTCAGGGAAAAGAGGCGCTTTATAGCGCGCCTTATGATGCGGTGATCCTGGATTTAACCT
TACCAGGCATGGATGGTCGCGATATTTTGCGCGAATGGCGAGAAAAAGGTCAGCGTGAGCCGGTACTGATCCTGACCGCG
CGCGATGCGCTGGAGGAACGTGTAGAAGGGCTGCGTCTGGGAGCTGACGATTATCTGTGTAAACCTTTTGCGTTGATAGA
AGTCGCCGCCAGGCTGGAAGCTCTGATGCGCCGAACCAACGGCCAGGCCAGCAACGAGCTGCGCCACGGTAACGTCATGC
TCGACCCCGGCAAACGTATCGCCACGCTGGCTGGCGAACCCTTAACACTGAAACCAAAAGAATTTGCCCTGCTGGAATTA
CTGATGCGTAACGCTGGTCGGGTACTGCCGCGCAAACTGATTGAAGAGAAACTGTATACCTGGGACGAAGAGGTCACCAG
TAATGCCGTTGAAGTGCATGTGCATCATCTGCGACGCAAACTCGGTAGTGATTTTATTCGTACCGTGCATGGTATTGGCT
ACACATTAGGTGAGAAATGA

Protein sequence :
MRILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGQREPVLILTA
RDALEERVEGLRLGADDYLCKPFALIEVAARLEALMRRTNGQASNELRHGNVMLDPGKRIATLAGEPLTLKPKEFALLEL
LMRNAGRVLPRKLIEEKLYTWDEEVTSNAVEVHVHHLRRKLGSDFIRTVHGIGYTLGEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-40 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qseB YP_006125905.1 DNA-binding response regulator in two-component regulatory system with QseC BAC0487 Protein 2e-40 44
qseB YP_006125905.1 DNA-binding response regulator in two-component regulatory system with QseC BAC0638 Protein 3e-31 44
qseB YP_006125905.1 DNA-binding response regulator in two-component regulatory system with QseC BAC0083 Protein 5e-37 43
qseB YP_006125905.1 DNA-binding response regulator in two-component regulatory system with QseC BAC0347 Protein 4e-34 43
qseB YP_006125905.1 DNA-binding response regulator in two-component regulatory system with QseC NC_002516.2.879194.p Protein 4e-31 41
qseB YP_006125905.1 DNA-binding response regulator in two-component regulatory system with QseC BAC0308 Protein 2e-36 41
qseB YP_006125905.1 DNA-binding response regulator in two-component regulatory system with QseC BAC0197 Protein 6e-36 41
qseB YP_006125905.1 DNA-binding response regulator in two-component regulatory system with QseC BAC0111 Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qseB YP_006125905.1 DNA-binding response regulator in two-component regulatory system with QseC VFG0473 Protein 2e-40 47
qseB YP_006125905.1 DNA-binding response regulator in two-component regulatory system with QseC VFG1390 Protein 3e-32 42