Gene Information

Name : ETEC_0210 (ETEC_0210)
Accession : YP_006113802.1
Strain : Escherichia coli ETEC H10407
Genome accession: NC_017633
Putative virulence/resistance : Virulence
Product : CP4-44 prophage; putative toxin of the YeeV-YeeU toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 242277 - 242600 bp
Length : 324 bp
Strand : -
Note : -

DNA sequence :
GTGGAGATCTGGCAACGGCTTCTGAGCCACCTGTTGGATCGTCACTACGGTCTGACGCTTAACGACACGCCGTTTGGCAA
CGACGGTGTGATTCAGGAGCATATCGACGCCGGTATATCACTGTGCGACGCCGTGAATTTTATTGTGGAGAAGTACGATC
TGGTGCGCATCGATCGTCACGGTTTCAGTACAGAAACACAGTTGCCGCGTCTCACCAGTATCGATATTCTCCGCGCCCGC
AAAGCCACCGGGTTGATGACTCGCAACGATTACAGAACGGTGACCGACATCACCACCGGTAAATACCGTGGGGGGCATCG
ATGA

Protein sequence :
MEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGFSTETQLPRLTSIDILRAR
KATGLMTRNDYRTVTDITTGKYRGGHR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 8e-31 69
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 8e-31 69
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 4e-32 67
unnamed AAL08478.1 unknown Not tested SRL Protein 2e-31 67
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 8e-32 66
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 3e-31 66
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 4e-32 66
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 1e-30 66
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 1e-30 66
unnamed AAC31486.1 L0007 Not tested LEE Protein 7e-31 66
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 7e-31 66
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 8e-31 65
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-30 65
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 7e-32 65
unnamed AAL57575.1 unknown Not tested LEE Protein 2e-30 65
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 1e-31 64
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 5e-32 64
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 1e-31 64
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 7e-32 64
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 6e-31 64
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 7e-32 64

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ETEC_0210 YP_006113802.1 CP4-44 prophage; putative toxin of the YeeV-YeeU toxin-antitoxin system VFG1069 Protein 8e-32 67
ETEC_0210 YP_006113802.1 CP4-44 prophage; putative toxin of the YeeV-YeeU toxin-antitoxin system VFG1530 Protein 2e-32 67
ETEC_0210 YP_006113802.1 CP4-44 prophage; putative toxin of the YeeV-YeeU toxin-antitoxin system VFG1682 Protein 3e-32 66
ETEC_0210 YP_006113802.1 CP4-44 prophage; putative toxin of the YeeV-YeeU toxin-antitoxin system VFG0786 Protein 3e-31 66
ETEC_0210 YP_006113802.1 CP4-44 prophage; putative toxin of the YeeV-YeeU toxin-antitoxin system VFG1620 Protein 3e-32 65
ETEC_0210 YP_006113802.1 CP4-44 prophage; putative toxin of the YeeV-YeeU toxin-antitoxin system VFG0663 Protein 2e-32 64