Gene Information

Name : UM146_21890 (UM146_21890)
Accession : YP_006113218.1
Strain : Escherichia coli UM146
Genome accession: NC_017632
Putative virulence/resistance : Unknown
Product : putative transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4575971 - 4576291 bp
Length : 321 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGATCAAAACTCGTCGGACTAAACGTACCTTTTCCCCGGAGTTCAAGCTTGAAGCTTTCGAGCAGGTGGTGGTTAAATA
CCAGCGTGATGTCAGAGAAGTCGCGCAGGCACTCGAGCTCAACCCTGACCATTTGCGTAAATGGATACGGTTGTATAAGC
AGGAACTTCAGGGTATTGAGCCAGCTGGTAATGCTATTACCCCTGAACAACGCGAAATTCAGCAGCTTAAAGCGCAGATA
AAGCGCGTTGAGATGGAAAAAGAAATACTAAAGCAGGCTGCCGTGCTGATGAGCGAAATCCCCGGGAAGCTGTCGCGCTA
A

Protein sequence :
MIKTRRTKRTFSPEFKLEAFEQVVVKYQRDVREVAQALELNPDHLRKWIRLYKQELQGIEPAGNAITPEQREIQQLKAQI
KRVEMEKEILKQAAVLMSEIPGKLSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-45 100
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 8e-40 92
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 45
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 45
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 45
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-13 45
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 45
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-13 45
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 45
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-13 45
api80 CAF28554.1 putative transposase Not tested YAPI Protein 4e-11 42
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-12 42
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-12 42
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 4e-14 41
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 3e-11 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UM146_21890 YP_006113218.1 putative transposase VFG1566 Protein 8e-46 100
UM146_21890 YP_006113218.1 putative transposase VFG1521 Protein 3e-40 92
UM146_21890 YP_006113218.1 putative transposase VFG1123 Protein 4e-14 45
UM146_21890 YP_006113218.1 putative transposase VFG1485 Protein 9e-13 42