Gene Information

Name : UM146_20495 (UM146_20495)
Accession : YP_006112941.1
Strain : Escherichia coli UM146
Genome accession: NC_017632
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional regulator SoxS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4287108 - 4287431 bp
Length : 324 bp
Strand : -
Note : COG2207 AraC-type DNA-binding domain-containing proteins

DNA sequence :
ATGTCCCATCAGAAAATTATTCAGGATCTTATCGCATGGATTGACGAGCATATTGACCAGCCGCTTAACATTGATGTCGT
CGCAAAAAAATCTGGCTATTCAAAGTGGTACTTGCAACGGATGTTCCGCACGGTGACGCATCAGACGCTTGGCGATTACA
TTCGCCAGCGCCGTCTGTTACTGGCCGCCGTTGAGTTGCGCACCACCGAGCGTCCGATTTTTGATATCGCAATGGACCTG
GGTTATGTCTCTCAGCAGACCTTCTCCCGCGTTTTCCGTCGGCAGTTTGATCGCACTCCCAGCGATTATCGCCACCGCCT
GTAG

Protein sequence :
MSHQKIIQDLIAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLLLAAVELRTTERPIFDIAMDL
GYVSQQTFSRVFRRQFDRTPSDYRHRL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-45 96
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 9e-22 51
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 9e-22 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS BAC0371 Protein 4e-47 100
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS NC_002695.1.914293.p Protein 4e-47 100
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS CP000034.1.gene4505. Protein 7e-47 99
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene4488. Protein 7e-46 96
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS CP001918.1.gene327.p Protein 6e-44 90
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS CP000647.1.gene4499. Protein 2e-43 89
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS NC_010558.1.6276025. Protein 4e-22 51
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene612.p Protein 5e-24 46
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS CP000647.1.gene1624. Protein 8e-20 43
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS CP001918.1.gene2033. Protein 1e-19 43
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS NC_002695.1.917339.p Protein 1e-19 42
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene1637. Protein 2e-19 42
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS BAC0560 Protein 1e-19 42
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS CP000034.1.gene1596. Protein 1e-19 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS VFG0585 Protein 6e-46 96
UM146_20495 YP_006112941.1 DNA-binding transcriptional regulator SoxS VFG1038 Protein 4e-22 51