Gene Information

Name : soxS (ECABU_c46040)
Accession : YP_006108529.1
Strain : Escherichia coli ABU 83972
Genome accession: NC_017631
Putative virulence/resistance : Resistance
Product : regulation of superoxide response regulon
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4698319 - 4698642 bp
Length : 324 bp
Strand : -
Note : -

DNA sequence : 
ATGTCCCATCAGAAAATTATTCAGGATCTTATCGCATGGATTGACGAGCATATTGACCAGCCGCTTAACATTGATGTCGT
CGCAAAAAAATCTGGCTATTCAAAGTGGTACTTGCAACGGATGTTCCGCACGGTGACGCATCAGACGCTTGGCGATTACA
TTCGCCAGCGCCGTCTGTTACTGGCCGCCGTTGAGTTGCTCACCACCGAGCGTCCGATTTTTGATATCGCAATGGACCTG
GGTTATGTCTCTCAGCAGACCTTCTCCCGCGTTTTCCGTCGGCAGTTTGATCGCACTCCCAGCGATTATCGCCACCGCCT
GTAG

Protein sequence : 
MSHQKIIQDLIAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLLLAAVELLTTERPIFDIAMDL
GYVSQQTFSRVFRRQFDRTPSDYRHRL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-37 95
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-16 50
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-16 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_006108529.1 regulation of superoxide response regulon BAC0371 Protein 3e-39 99
soxS YP_006108529.1 regulation of superoxide response regulon NC_002695.1.914293.p Protein 3e-39 99
soxS YP_006108529.1 regulation of superoxide response regulon CP000034.1.gene4505. Protein 5e-39 99
soxS YP_006108529.1 regulation of superoxide response regulon CP001138.1.gene4488. Protein 4e-38 95
soxS YP_006108529.1 regulation of superoxide response regulon CP001918.1.gene327.p Protein 2e-37 89
soxS YP_006108529.1 regulation of superoxide response regulon CP000647.1.gene4499. Protein 9e-37 88
soxS YP_006108529.1 regulation of superoxide response regulon NC_010558.1.6276025. Protein 5e-17 50
soxS YP_006108529.1 regulation of superoxide response regulon CP001138.1.gene612.p Protein 2e-18 45
soxS YP_006108529.1 regulation of superoxide response regulon CP000647.1.gene1624. Protein 1e-16 43
soxS YP_006108529.1 regulation of superoxide response regulon CP001918.1.gene2033. Protein 2e-16 43
soxS YP_006108529.1 regulation of superoxide response regulon CP001138.1.gene1637. Protein 2e-16 42
soxS YP_006108529.1 regulation of superoxide response regulon BAC0560 Protein 2e-16 42
soxS YP_006108529.1 regulation of superoxide response regulon NC_002695.1.917339.p Protein 2e-16 42
soxS YP_006108529.1 regulation of superoxide response regulon CP000034.1.gene1596. Protein 1e-16 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_006108529.1 regulation of superoxide response regulon VFG0585 Protein 4e-38 95
soxS YP_006108529.1 regulation of superoxide response regulon VFG1038 Protein 4e-17 50