
|
Name : ECABU_c03460 (ECABU_c03460) Accession : YP_006104481.1 Strain : Escherichia coli ABU 83972 Genome accession: NC_017631 Putative virulence/resistance : Virulence Product : putative phage transcriptional AlpA-like regulator Function : - COG functional category : - COG ID : - EC number : - Position : 363246 - 363449 bp Length : 204 bp Strand : + Note : - DNA sequence : ATGGCTAATTACAATTCATTAATTCGTCTCTCTGAAGTTCAAAGGCGAACTGGTTATAGCAAAGCATGGATTTATCGTCT TATTAGTCAGGGGAGGTTCCCTAAACAGGTAAAAATTGGAAGTCGGGCAATTGCTTTTGTTGAGTCTGAAATAGATGAAT GGATTGAGAAGTGTATATTAGAATCTAGAGACGAGGTGGCCTGA Protein sequence : MANYNSLIRLSEVQRRTGYSKAWIYRLISQGRFPKQVKIGSRAIAFVESEIDEWIEKCILESRDEVA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-07 | 48 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-07 | 48 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-07 | 48 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 8e-08 | 46 |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 6e-08 | 46 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 6e-08 | 46 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 6e-08 | 46 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 4e-08 | 46 |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 1e-05 | 44 |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 3e-05 | 42 |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 8e-05 | 42 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 8e-05 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| ECABU_c03460 | YP_006104481.1 | putative phage transcriptional AlpA-like regulator | VFG1118 | Protein | 8e-08 | 48 |
| ECABU_c03460 | YP_006104481.1 | putative phage transcriptional AlpA-like regulator | VFG1141 | Protein | 2e-08 | 46 |