Name : EC042_1766 (EC042_1766) Accession : YP_006096079.1 Strain : Escherichia coli 042 Genome accession: NC_017626 Putative virulence/resistance : Virulence Product : putative prophage regulatory protein Function : - COG functional category : - COG ID : - EC number : - Position : 1841586 - 1841774 bp Length : 189 bp Strand : - Note : - DNA sequence : GTGTTAAGCACTGATCGGTTTATACGTGAAAAAGAATGCGAAAAACTAACCGGCCTTAGCCGTACGTGTCGCTACCGCCT GGAAAAGGCCGGACAATTCCCATCACGTCGTAAACTTGGCGGTCGTTCCGTTGGCTGGTCTTTATCCGAGGTTCTGGCCT GGAAGGATAGCTGCAAGGCAGTTCATTAA Protein sequence : MLSTDRFIREKECEKLTGLSRTCRYRLEKAGQFPSRRKLGGRSVGWSLSEVLAWKDSCKAVH |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-06 | 44 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-06 | 44 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-06 | 44 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 0.078 | 42 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 0.068 | 42 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 0.11 | 42 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 0.11 | 42 |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 2e-06 | 42 |
ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 4e-05 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
EC042_1766 | YP_006096079.1 | putative prophage regulatory protein | VFG1118 | Protein | 9e-07 | 44 |
EC042_1766 | YP_006096079.1 | putative prophage regulatory protein | VFG0651 | Protein | 0.032 | 42 |