
|
Name : EcDH1_3360 (EcDH1_3360) Accession : YP_006093269.1 Strain : Escherichia coli DH1 Genome accession: NC_017625 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 3607907 - 3608128 bp Length : 222 bp Strand : + Note : PFAM: protein of unknown function DUF987; KEGG: seg:SG0269 hypothetical protein DNA sequence : ATGAAAATTATCAGTAAACGCAGGGCAATGACGATATACCGCCAGCATCCTGAGTCCCGAATCTTTCGCTACTGCACCGG CAAATACCAGTGGCACGGTAGCGTCTGTCATTACACCGGCAGGGACGTTCCGGATATCGCCGGAGTCCTCGCGGTATACG CCGAACGCCGCCAGGACCGCAATGGGCCCTATACCTGCCTGATGAGCATCACCCTGAACTGA Protein sequence : MKIISKRRAMTIYRQHPESRIFRYCTGKYQWHGSVCHYTGRDVPDIAGVLAVYAERRQDRNGPYTCLMSITLN |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | AAK00480.1 | unknown | Not tested | SHI-1 | Protein | 8e-18 | 69 |
| yeeT | CAE85202.1 | YeeT protein | Not tested | PAI V 536 | Protein | 3e-20 | 68 |
| unnamed | CAD66204.1 | hypothetical protein | Not tested | PAI III 536 | Protein | 3e-20 | 68 |
| yeeT | CAD42099.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 3e-20 | 68 |
| yeeT | NP_838485.1 | hypothetical protein | Not tested | SHI-1 | Protein | 5e-20 | 68 |
| yeeT | NP_708771.1 | hypothetical protein | Not tested | SHI-1 | Protein | 5e-20 | 68 |
| aec74 | AAW51757.1 | Aec74 | Not tested | AGI-3 | Protein | 4e-20 | 66 |
| c5151 | NP_756999.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 1e-19 | 66 |
| yeeT | ADD91701.1 | YeeT | Not tested | PAI-I AL862 | Protein | 1e-19 | 66 |
| yeeT | CAD33788.1 | YeeT protein | Not tested | PAI I 536 | Protein | 9e-20 | 66 |
| unnamed | AAL67344.1 | intergenic-region protein | Not tested | PAI II CFT073 | Protein | 8e-20 | 66 |
| yeeT | AAK16199.1 | YeeT | Not tested | PAI-I AL862 | Protein | 8e-20 | 66 |
| yeeT | AAZ04459.1 | conserved hypothetical protein | Not tested | PAI I APEC-O1 | Protein | 8e-20 | 66 |
| unnamed | CAI43847.1 | hypothetical protein | Not tested | LEE | Protein | 2e-19 | 65 |
| Z1218 | NP_286753.1 | hypothetical protein | Not tested | TAI | Protein | 2e-19 | 65 |
| unnamed | AAL08476.1 | unknown | Not tested | SRL | Protein | 1e-19 | 65 |
| ECO103_3590 | YP_003223447.1 | hypothetical protein | Not tested | LEE | Protein | 6e-19 | 64 |
| unnamed | AAL57578.1 | unknown | Not tested | LEE | Protein | 1e-16 | 62 |
| unnamed | CAI43902.1 | hypothetical protein | Not tested | LEE | Protein | 1e-16 | 62 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| EcDH1_3360 | YP_006093269.1 | hypothetical protein | VFG1679 | Protein | 1e-20 | 68 |
| EcDH1_3360 | YP_006093269.1 | hypothetical protein | VFG0661 | Protein | 1e-20 | 68 |
| EcDH1_3360 | YP_006093269.1 | hypothetical protein | VFG1618 | Protein | 1e-20 | 68 |
| EcDH1_3360 | YP_006093269.1 | hypothetical protein | VFG1529 | Protein | 4e-20 | 66 |
| EcDH1_3360 | YP_006093269.1 | hypothetical protein | VFG1067 | Protein | 5e-20 | 65 |