Gene Information

Name : EcDH1_3360 (EcDH1_3360)
Accession : YP_006093269.1
Strain : Escherichia coli DH1
Genome accession: NC_017625
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3607907 - 3608128 bp
Length : 222 bp
Strand : +
Note : PFAM: protein of unknown function DUF987; KEGG: seg:SG0269 hypothetical protein

DNA sequence :
ATGAAAATTATCAGTAAACGCAGGGCAATGACGATATACCGCCAGCATCCTGAGTCCCGAATCTTTCGCTACTGCACCGG
CAAATACCAGTGGCACGGTAGCGTCTGTCATTACACCGGCAGGGACGTTCCGGATATCGCCGGAGTCCTCGCGGTATACG
CCGAACGCCGCCAGGACCGCAATGGGCCCTATACCTGCCTGATGAGCATCACCCTGAACTGA

Protein sequence :
MKIISKRRAMTIYRQHPESRIFRYCTGKYQWHGSVCHYTGRDVPDIAGVLAVYAERRQDRNGPYTCLMSITLN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAK00480.1 unknown Not tested SHI-1 Protein 8e-18 69
unnamed CAD66204.1 hypothetical protein Not tested PAI III 536 Protein 3e-20 68
yeeT CAD42099.1 hypothetical protein Not tested PAI II 536 Protein 3e-20 68
yeeT NP_838485.1 hypothetical protein Not tested SHI-1 Protein 5e-20 68
yeeT NP_708771.1 hypothetical protein Not tested SHI-1 Protein 5e-20 68
yeeT CAE85202.1 YeeT protein Not tested PAI V 536 Protein 3e-20 68
c5151 NP_756999.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-19 66
yeeT ADD91701.1 YeeT Not tested PAI-I AL862 Protein 1e-19 66
yeeT CAD33788.1 YeeT protein Not tested PAI I 536 Protein 9e-20 66
unnamed AAL67344.1 intergenic-region protein Not tested PAI II CFT073 Protein 8e-20 66
yeeT AAK16199.1 YeeT Not tested PAI-I AL862 Protein 8e-20 66
yeeT AAZ04459.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 8e-20 66
aec74 AAW51757.1 Aec74 Not tested AGI-3 Protein 4e-20 66
Z1218 NP_286753.1 hypothetical protein Not tested TAI Protein 2e-19 65
unnamed AAL08476.1 unknown Not tested SRL Protein 1e-19 65
unnamed CAI43847.1 hypothetical protein Not tested LEE Protein 2e-19 65
ECO103_3590 YP_003223447.1 hypothetical protein Not tested LEE Protein 6e-19 64
unnamed AAL57578.1 unknown Not tested LEE Protein 1e-16 62
unnamed CAI43902.1 hypothetical protein Not tested LEE Protein 1e-16 62

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcDH1_3360 YP_006093269.1 hypothetical protein VFG1618 Protein 1e-20 68
EcDH1_3360 YP_006093269.1 hypothetical protein VFG1679 Protein 1e-20 68
EcDH1_3360 YP_006093269.1 hypothetical protein VFG0661 Protein 1e-20 68
EcDH1_3360 YP_006093269.1 hypothetical protein VFG1529 Protein 4e-20 66
EcDH1_3360 YP_006093269.1 hypothetical protein VFG1067 Protein 5e-20 65