Gene Information

Name : SSGZ1_1207 (SSGZ1_1207)
Accession : YP_006074606.1
Strain : Streptococcus suis GZ1
Genome accession: NC_017617
Putative virulence/resistance : Virulence
Product : Response regulator receiver: Transcriptional regulatory protein, C-terminal
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1249639 - 1250343 bp
Length : 705 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAAAATATTAATTGTAGATGATGAAAAACCAATCTCAGATATTATTAAGTTTAATATGACGCGTGAGGGATATGA
AGTTGTGACAGCTTTCGATGGACGTGAAGCCTTGGAAGTATTTGAGGCTGAGTTTCCTGACATTGTCATTTTGGACTTGA
TGTTGCCAGAATTGGACGGACTAGAGGTTGCTCGAACGATTCGTAAGACCAGCAATGTTCCAATCTTGATGTTATCTGCT
AAAGATAGCGAATTTGATAAGGTTATCGGGCTTGAAATAGGGGCGGATGATTATGTGACCAAGCCCTTCTCTAATCGCGA
ATTACAGGCGCGTGTTAAGGCTCTTCTTCGTCGTAGTGAATTGGCAGAGACGCAGACAAATATTGAGTCAACAGGAACTC
CAGAGTTGGTGATTGGCGATTTGGTCATTCTGCCTGATGCGTTTGTTGCTAAGAAGCATGGTAAAGAGCTGGAGCTGACC
CATCGTGAGTTTGAATTGCTCCACCATCTGGCCAAACACTTAGGTCAGGTTATGACTCGAGAACATCTATTGGAAACAGT
TTGGGGTTATGATTACTTTGGTGATGTCCGCACGGTGGATGTAACGATTCGTCGTCTGCGTGAGAAAATTGAAGATACAC
CAAGCAGACCAGAATACATTCTTACTCGTCGCGGAGTGGGATATTTTATAAAAGGAAATGATTAA

Protein sequence :
MKKILIVDDEKPISDIIKFNMTREGYEVVTAFDGREALEVFEAEFPDIVILDLMLPELDGLEVARTIRKTSNVPILMLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELQARVKALLRRSELAETQTNIESTGTPELVIGDLVILPDAFVAKKHGKELELT
HREFELLHHLAKHLGQVMTREHLLETVWGYDYFGDVRTVDVTIRRLREKIEDTPSRPEYILTRRGVGYFIKGND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-38 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_012469.1.7685629. Protein 2e-90 82
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_002952.2859905.p0 Protein 5e-55 55
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_002758.1121668.p0 Protein 4e-55 55
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_009641.5332272.p0 Protein 4e-55 55
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_013450.8614421.p0 Protein 4e-55 55
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_007793.3914279.p0 Protein 4e-55 55
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_002745.1124361.p0 Protein 4e-55 55
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_009782.5559369.p0 Protein 4e-55 55
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_002951.3237708.p0 Protein 4e-55 55
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_007622.3794472.p0 Protein 5e-55 55
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_003923.1003749.p0 Protein 4e-55 54
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal HE999704.1.gene2815. Protein 1e-53 54
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal AE016830.1.gene1681. Protein 7e-49 48
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_012469.1.7686381. Protein 2e-47 48
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal FJ349556.1.orf0.gene Protein 2e-40 45
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal AF155139.2.orf0.gene Protein 4e-40 45
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal AM180355.1.gene1830. Protein 5e-40 44
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal HE999704.1.gene1528. Protein 1e-35 43
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_002695.1.915041.p Protein 7e-34 43
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal CP000034.1.gene3834. Protein 7e-34 43
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_005054.2598277.p0 Protein 8e-39 43
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_014475.1.orf0.gen Protein 8e-39 43
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal DQ212986.1.gene4.p01 Protein 3e-38 43
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_003923.1003417.p0 Protein 2e-39 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_013450.8614146.p0 Protein 2e-39 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_002951.3238224.p0 Protein 2e-39 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_007793.3914065.p0 Protein 2e-39 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_002758.1121390.p0 Protein 2e-39 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_010079.5776364.p0 Protein 2e-39 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_002952.2859858.p0 Protein 2e-39 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal NC_007622.3794948.p0 Protein 2e-39 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal CP001138.1.gene4273. Protein 6e-33 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal BAC0533 Protein 4e-33 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal CP000647.1.gene4257. Protein 4e-33 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal AF162694.1.orf4.gene Protein 3e-35 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal CP001918.1.gene5135. Protein 3e-28 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal AE000516.2.gene3505. Protein 3e-36 42
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal AE015929.1.gene1106. Protein 8e-34 41
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal CP004022.1.gene3215. Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal VFG1563 Protein 5e-38 45
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal VFG1702 Protein 9e-38 44
SSGZ1_1207 YP_006074606.1 Response regulator receiver: Transcriptional regulatory protein, C-terminal VFG1389 Protein 5e-32 43