Gene Information

Name : TtJL18_0326 (TtJL18_0326)
Accession : YP_006058023.1
Strain : Thermus thermophilus JL-18
Genome accession: NC_017587
Putative virulence/resistance : Resistance
Product : copper chaperone
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 293365 - 293565 bp
Length : 201 bp
Strand : -
Note : PFAM: Heavy-metal-associated domain; TIGRFAM: copper ion binding protein

DNA sequence :
ATGCCGAAGCTCAAGGTGGAAGGCATGACCTGCAACCACTGCGTGATGGCGGTGACCAAGGCCCTGAAGAAGGTCCCCGG
CGTGGAGAAGGTAGAGGTCTCCCTAGAAAAGGGGGAGGCCCTGGTGGAGGGGACGGCCGACCCCAAGGCCCTCGTCCAGG
CGGTGGAGGAGGAAGGGTACAAGGCCGAGGTTCTGGCCTAA

Protein sequence :
MPKLKVEGMTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 1e-08 49
merP AFG30122.1 MerP Not tested PAGI-2 Protein 9e-08 46
merP AGK07023.1 MerP Not tested SGI1 Protein 9e-08 46
merP AGK07081.1 MerP Not tested SGI1 Protein 9e-08 46
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-07 46
merP ABQ57373.1 MerP Not tested SGI1 Protein 9e-08 46
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 9e-08 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TtJL18_0326 YP_006058023.1 copper chaperone BAC0231 Protein 7e-08 43
TtJL18_0326 YP_006058023.1 copper chaperone BAC0085 Protein 2e-04 41
TtJL18_0326 YP_006058023.1 copper chaperone BAC0679 Protein 2e-07 41