Gene Information

Name : SCATT_37860 (SCATT_37860)
Accession : YP_006055680.1
Strain : Streptomyces cattleya NRRL 8057
Genome accession: NC_017586
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4074946 - 4075632 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGACCTTCGTGCCCTTCCTGTTGCTTATCGAGGACGACGACGCCATCCGCACGGGCCTCGAACTGGCCCTGACCCGGCA
GGGCCACCGCGTGGTGGCCGCCGCGTCCGGCGAGGAGGGTCTGGACCGCCTGCGCGAACAGCGTCCGGACCTGATCGTGC
TGGACGTGATGCTGCCGGGGATCGACGGGTTCGAGGTGTGCCGCCGCATCCGCCGTACCGACCAGTTGCCGATCATCCTG
CTCACCGCCCGCAGCGACGACATCGATGTCGTCGTCGGGCTGGAGTCGGGCGCCGACGACTACGTGGTCAAGCCGATCCA
GCCACGGGTGCTGGACGCGCGCATCCGGGCCGTGCTGCGCCGCGGCGAGCGGGACAGCACCGACTCGGTGGCGTTCGGCT
CGATCGTGATCGACCGCTCGGCGATGACGGTGACCAAGGACGGCGAGGATCTCCAGCTGACCCCGACCGAGCTGCGGCTG
CTGCTGGAGCTGAGCCGCCGCCCGGGGCAGGCGCTCTCCCGCCAGCAGTTGCTGCGCCTGGTGTGGGAGCACGATTACCT
GGGCGATTCGCGGCTGGTCGACGCGTGTGTGCAGCGGCTGCGGGCCAAGGTGGAGGACGTGCCGTCCTCGCCGAAGCTGA
TCCGTACCGTGCGCGGCGTGGGTTACCGGCTGGACGCTCCGCAGTGA

Protein sequence :
MTFVPFLLLIEDDDAIRTGLELALTRQGHRVVAAASGEEGLDRLREQRPDLIVLDVMLPGIDGFEVCRRIRRTDQLPIIL
LTARSDDIDVVVGLESGADDYVVKPIQPRVLDARIRAVLRRGERDSTDSVAFGSIVIDRSAMTVTKDGEDLQLTPTELRL
LLELSRRPGQALSRQQLLRLVWEHDYLGDSRLVDACVQRLRAKVEDVPSSPKLIRTVRGVGYRLDAPQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCATT_37860 YP_006055680.1 two-component system response regulator NC_002952.2859905.p0 Protein 5e-40 45
SCATT_37860 YP_006055680.1 two-component system response regulator NC_002745.1124361.p0 Protein 8e-40 45
SCATT_37860 YP_006055680.1 two-component system response regulator NC_009782.5559369.p0 Protein 8e-40 45
SCATT_37860 YP_006055680.1 two-component system response regulator NC_002951.3237708.p0 Protein 8e-40 45
SCATT_37860 YP_006055680.1 two-component system response regulator NC_003923.1003749.p0 Protein 7e-40 45
SCATT_37860 YP_006055680.1 two-component system response regulator NC_002758.1121668.p0 Protein 8e-40 45
SCATT_37860 YP_006055680.1 two-component system response regulator NC_009641.5332272.p0 Protein 8e-40 45
SCATT_37860 YP_006055680.1 two-component system response regulator NC_013450.8614421.p0 Protein 8e-40 45
SCATT_37860 YP_006055680.1 two-component system response regulator NC_007793.3914279.p0 Protein 8e-40 45
SCATT_37860 YP_006055680.1 two-component system response regulator NC_007622.3794472.p0 Protein 5e-40 45
SCATT_37860 YP_006055680.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-35 45
SCATT_37860 YP_006055680.1 two-component system response regulator NC_012469.1.7685629. Protein 3e-39 43
SCATT_37860 YP_006055680.1 two-component system response regulator NC_002952.2859858.p0 Protein 3e-33 42
SCATT_37860 YP_006055680.1 two-component system response regulator NC_007622.3794948.p0 Protein 3e-33 42
SCATT_37860 YP_006055680.1 two-component system response regulator NC_003923.1003417.p0 Protein 3e-33 42
SCATT_37860 YP_006055680.1 two-component system response regulator NC_013450.8614146.p0 Protein 3e-33 42
SCATT_37860 YP_006055680.1 two-component system response regulator NC_002951.3238224.p0 Protein 3e-33 42
SCATT_37860 YP_006055680.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-27 42
SCATT_37860 YP_006055680.1 two-component system response regulator NC_007793.3914065.p0 Protein 3e-33 42
SCATT_37860 YP_006055680.1 two-component system response regulator NC_002758.1121390.p0 Protein 3e-33 42
SCATT_37860 YP_006055680.1 two-component system response regulator NC_010079.5776364.p0 Protein 3e-33 42
SCATT_37860 YP_006055680.1 two-component system response regulator CP000675.2.gene1535. Protein 2e-28 42
SCATT_37860 YP_006055680.1 two-component system response regulator BAC0197 Protein 1e-26 42
SCATT_37860 YP_006055680.1 two-component system response regulator CP001918.1.gene3444. Protein 9e-24 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCATT_37860 YP_006055680.1 two-component system response regulator VFG1390 Protein 2e-27 41
SCATT_37860 YP_006055680.1 two-component system response regulator VFG0596 Protein 3e-23 41
SCATT_37860 YP_006055680.1 two-component system response regulator VFG1389 Protein 3e-23 41