Gene Information

Name : SCATT_14790 (SCATT_14790)
Accession : YP_006053372.1
Strain : Streptomyces cattleya NRRL 8057
Genome accession: NC_017586
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1597309 - 1597884 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGTGGCAACGTCTCGCTGACCAAGGAGGCGCCCAACCTCACCGCCGTCCACGTCGGCCT
CGGCTGGGACGCGCGCACCACCACCGGCGCCGACTTCGACCTGGACGCCAGCGCCCTGCTGACCGACGCGGCCGGCAAGG
TCCTCACGGACCAGCACTTCGTCTTCTTCAACAACCTCAAGAGCCCGGACGGCTCGGTCGAGCACACCGGGGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGGTGATCAACGTCGACCTGGCCGCCGTCCCGGCCGACGTCGCCAAGATCGTCTT
CCCGGTCTCCATCTACGAGGCCGAGAGCCGCCAGCAGAGCTTCGGCCAGGTGCGCAACGCCTACATCCGGGTGGTCAACC
AGGCCGACCAGAAGGAGATCGCCCGCTACGACCTCACCGAGGACGCCTCCACCGAGACCGCCATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCCGAGTGGAAGTTCCGGGCCATCGGCCAGGGGTACGCCTCCGGACTGCGCGGCATCGCCCAGGACTT
CGGCGTCAACGTCTAG

Protein sequence :
MGVSLSKGGNVSLTKEAPNLTAVHVGLGWDARTTTGADFDLDASALLTDAAGKVLTDQHFVFFNNLKSPDGSVEHTGDNL
TGEGEGDDEVINVDLAAVPADVAKIVFPVSIYEAESRQQSFGQVRNAYIRVVNQADQKEIARYDLTEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-52 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-53 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-54 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-54 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-54 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-53 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-53 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-55 64
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-28 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCATT_14790 YP_006053372.1 stress protein BAC0389 Protein 7e-54 66
SCATT_14790 YP_006053372.1 stress protein BAC0390 Protein 6e-54 64
SCATT_14790 YP_006053372.1 stress protein BAC0392 Protein 2e-26 44