Gene Information

Name : SCATT_p06410 (SCATT_p06410)
Accession : YP_006050787.1
Strain :
Genome accession: NC_017585
Putative virulence/resistance : Virulence
Product : putative two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 641149 - 641826 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGCGGCTGCTGATCGTCGAGGACGAGCGGCGCCTGGCCGTGACGCTGGCCAGGGGCCTGGTGGCGGACGGTTTCGCGGT
GGACGTCGCGCACGACGGGGTGCAGGGGCTGCACATGGCGGCGACCGGCACGTACGACCTGGTGGTCCTGGACCTGATGC
TGCCCGGCATGAGCGGCTACCGGGTCTGCGCCCGGCTGCGGGTCGACGGCGACACCACGCCGATCCTGATGCTCACCGCC
AAGGACGGCGAGTACGACGAGGCGGAGGGGCTGGACACCGGCGCCGACGACTACCTGACGAAGCCGTTCTCCTACGTGGT
GCTGCTGGCCAGGATCCGGGCGCTGCTGCGGCGCCGTACCCGGGGCGGCACCCCGGTGCTGCGGCTGGGCACGCTGACCG
TGGACCCGGCGGCCCGGCGCTGCTTCCGGGAGGACCGCGAGGTGCCGCTGACCGCCAAGGAGTTCGCGGTGCTGGAGCAT
CTGGCGGTCCACGCCGGCCAGGTGGTCTCCAAGGCCGAGATCCTCGACCACGTGTGGGACTTCGCCTACGACGGCGACCC
CAACATCGTCGAGGTGTACATCAGCGCGCTGCGCCGGAAGATCGACGCGCCGTTCGGCCGCCGGTCGATCACCACGGCGC
GCGGCGCCGGGTACCGGCTGGCGGCCGACGGTGGCTGA

Protein sequence :
MRLLIVEDERRLAVTLARGLVADGFAVDVAHDGVQGLHMAATGTYDLVVLDLMLPGMSGYRVCARLRVDGDTTPILMLTA
KDGEYDEAEGLDTGADDYLTKPFSYVVLLARIRALLRRRTRGGTPVLRLGTLTVDPAARRCFREDREVPLTAKEFAVLEH
LAVHAGQVVSKAEILDHVWDFAYDGDPNIVEVYISALRRKIDAPFGRRSITTARGAGYRLAADGG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCATT_p06410 YP_006050787.1 putative two-component system response regulator BAC0125 Protein 2e-37 46
SCATT_p06410 YP_006050787.1 putative two-component system response regulator U82965.2.orf14.gene. Protein 1e-25 46
SCATT_p06410 YP_006050787.1 putative two-component system response regulator Y16952.3.orf35.gene. Protein 2e-25 45
SCATT_p06410 YP_006050787.1 putative two-component system response regulator BAC0197 Protein 2e-34 45
SCATT_p06410 YP_006050787.1 putative two-component system response regulator BAC0111 Protein 3e-36 43
SCATT_p06410 YP_006050787.1 putative two-component system response regulator BAC0083 Protein 2e-34 43
SCATT_p06410 YP_006050787.1 putative two-component system response regulator BAC0308 Protein 1e-34 43
SCATT_p06410 YP_006050787.1 putative two-component system response regulator BAC0638 Protein 1e-30 42
SCATT_p06410 YP_006050787.1 putative two-component system response regulator NC_002516.2.879194.p Protein 7e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCATT_p06410 YP_006050787.1 putative two-component system response regulator VFG1390 Protein 5e-36 45
SCATT_p06410 YP_006050787.1 putative two-component system response regulator VFG1386 Protein 2e-29 42
SCATT_p06410 YP_006050787.1 putative two-component system response regulator VFG0596 Protein 9e-33 41