Gene Information

Name : F11_04615 (F11_04615)
Accession : YP_006047190.1
Strain : Rhodospirillum rubrum F11
Genome accession: NC_017584
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1070304 - 1070882 bp
Length : 579 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCTGTGTCCCTGTCGAAAGGCGGCAACGTTTCCTTGAGCAAGGAGGCTCCCGGTCTTACCGCCATCAATGTTGGTCT
GGGTTGGGATGCCCGCGTTACCGACGGTTCCGCCTTCGATCTCGATGCCTCGGCCTTCCTGTTGAATGAAGCCGGCAAGA
TCCGCTCCGACGCCGACTTCATTTTCTACAACAACAAGACCTCCTCCGACGGCTCGGTCGTCCATCAGGGCGACAACCAG
TCGGGCGCCGGCGAGGGTGATGACGAGACCGTGGCGATCGATCTGACCAAGGTGCCCGCCGACGTGCAGAAGGTGGCCTT
CTCGGTGACCATCCACGAAGCCGACGCCCGCAAGCAGAATTTCGGTCAGGTGACCAACGCCTTCATCCGCGTCGTCAATC
AGGCCGATGGCAAGGAGATCACCCGCTACGACCTGTCGGAAGACTATTCGACCGAAACCGCGATGATCTTTGGCGAGTTG
TACCGCAACGGCGCCGACTGGAAGTTCAAGGCCATCGGCCAGGGCTTCGCCGGCGGCCTTGGCCCCTTGGCCAAGAATTT
CGGCGTCAACATCGGCTAA

Protein sequence :
MAVSLSKGGNVSLSKEAPGLTAINVGLGWDARVTDGSAFDLDASAFLLNEAGKIRSDADFIFYNNKTSSDGSVVHQGDNQ
SGAGEGDDETVAIDLTKVPADVQKVAFSVTIHEADARKQNFGQVTNAFIRVVNQADGKEITRYDLSEDYSTETAMIFGEL
YRNGADWKFKAIGQGFAGGLGPLAKNFGVNIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-62 72
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-61 69
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-61 69
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-61 69
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-65 68
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-62 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-62 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-61 64
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
F11_04615 YP_006047190.1 stress protein BAC0390 Protein 4e-65 72
F11_04615 YP_006047190.1 stress protein BAC0389 Protein 1e-60 64