Gene Information

Name : rr01 (STH8232_0411)
Accession : YP_006040112.1
Strain : Streptococcus thermophilus JIM 8232
Genome accession: NC_017581
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 331667 - 332356 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence :
ATGAGCAAACGCATTTTGATTGTTGAAGATGAGAGAAACCTTGCTCGTTTTGTCTCTCTTGAACTTCAACACGAAGGATA
CGACGTTGTGACAGCGGACAACGGACGCGAAGGACTTGAAATGGCACTTGAGAAAGATTTCGATCTTATTCTCTTGGACC
TTATGTTGCCTGAGATGGACGGTTTCGAAGTGACACGTCGTCTCCAACAAGAAAAAGATACTTATATTATGATGATGACA
GCTCGCGACTCAATCATGGATATTGTTGCTGGTTTGGATCGTGGAGCTGATGACTATATTATAAAACCATTTGCGATTGA
AGAACTGTTGGCACGTATTCGTGCAACTTTCCGTCGTCAAGATATCGAAGCTACTAAGAAGGCACCAGCTAAAGCGTCAA
CCTATCGCGATTTAAAATTGGATGTTCAAAACCGTGCAGTTGTTCGCGGTGATGAGGTAATTCCATTGACAAAACGTGAG
TTTGATTTGTTGAACACACTTTTAAGCAATATGAACCAAGTAATGACCCGTGAGGAACTCTTGCTTCAAGTCTGGAAATA
TGATGACGTAATTGAAACAAACGTTGTAGATGTTTATATTCGTTACTTACGTGGGAAAATCGACATTCCAGGTAAGGAAT
CATACATTCAAACAGTACGAGGGATGGGTTACGTTATCCGTGAAAGATGA

Protein sequence :
MSKRILIVEDERNLARFVSLELQHEGYDVVTADNGREGLEMALEKDFDLILLDLMLPEMDGFEVTRRLQQEKDTYIMMMT
ARDSIMDIVAGLDRGADDYIIKPFAIEELLARIRATFRRQDIEATKKAPAKASTYRDLKLDVQNRAVVRGDEVIPLTKRE
FDLLNTLLSNMNQVMTREELLLQVWKYDDVIETNVVDVYIRYLRGKIDIPGKESYIQTVRGMGYVIRER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-35 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rr01 YP_006040112.1 response regulator HE999704.1.gene1528. Protein 2e-59 60
rr01 YP_006040112.1 response regulator NC_002952.2859858.p0 Protein 5e-49 52
rr01 YP_006040112.1 response regulator NC_007622.3794948.p0 Protein 5e-49 52
rr01 YP_006040112.1 response regulator NC_003923.1003417.p0 Protein 5e-49 52
rr01 YP_006040112.1 response regulator NC_013450.8614146.p0 Protein 5e-49 52
rr01 YP_006040112.1 response regulator NC_002951.3238224.p0 Protein 5e-49 52
rr01 YP_006040112.1 response regulator NC_007793.3914065.p0 Protein 5e-49 52
rr01 YP_006040112.1 response regulator NC_002758.1121390.p0 Protein 5e-49 52
rr01 YP_006040112.1 response regulator NC_010079.5776364.p0 Protein 5e-49 52
rr01 YP_006040112.1 response regulator AE015929.1.gene1106. Protein 6e-46 52
rr01 YP_006040112.1 response regulator BAC0125 Protein 9e-38 45
rr01 YP_006040112.1 response regulator NC_012469.1.7685629. Protein 5e-36 44
rr01 YP_006040112.1 response regulator AE000516.2.gene3505. Protein 2e-34 43
rr01 YP_006040112.1 response regulator HE999704.1.gene2815. Protein 9e-40 43
rr01 YP_006040112.1 response regulator BAC0308 Protein 8e-35 41
rr01 YP_006040112.1 response regulator BAC0111 Protein 3e-33 41
rr01 YP_006040112.1 response regulator AE016830.1.gene1681. Protein 1e-40 41
rr01 YP_006040112.1 response regulator BAC0197 Protein 9e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rr01 YP_006040112.1 response regulator VFG1390 Protein 1e-40 46
rr01 YP_006040112.1 response regulator VFG1389 Protein 4e-34 43
rr01 YP_006040112.1 response regulator VFG0596 Protein 7e-36 42
rr01 YP_006040112.1 response regulator VFG1386 Protein 3e-38 41