Gene Information

Name : phoB (SGGB_1944)
Accession : YP_006034757.1
Strain : Streptococcus gallolyticus ATCC 43143
Genome accession: NC_017576
Putative virulence/resistance : Resistance
Product : OmpR family two component system phosphate regulon response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2001209 - 2001886 bp
Length : 678 bp
Strand : -
Note : functional classification: COG0745(T)

DNA sequence :
ATGATTTATTGTGTTGAAGATGATGATGATATCCGTGAATTAATGCTGTACACGTTAAAGACGACTGGTTTTGTTGCGCA
AGGATTTCCAAATGCTGAGCTATTTTGGCAAGCTATAGAAAGTCAGAAACCTGACTTAATTTTATTGGATATTATGTTGC
CTGGAAGTGATGGCTTAAGCATTTTAGAAGAATTAAAAGGAAAAATGTCTACTGCGGACATTCCAGTGATTATGGCGACT
GCTAAGGGGACAGAATTTGATAAAGTTAAAGGATTGGATATGGGATCCGATGATTATTTGGTTAAACCTTTTGGCATGAT
GGAAATGATTTCGCGTATTAAAGCTGTTTTACGTAGAAGCCAAAAATCGCAAAGAAAACAGATATTACAGGTTGGAAACC
TTTCTTTAGATATTCAAAATTATACAGTAAAAAAAGATGGTAAAGACATTAGCTTAACGCTTAAAGAGTTTGAACTACTT
GGACTTCTTATGAAATATCCAAACCGCGTCTTTACACGTCAAGAATTATTAAATCAAGTCTGGGGAGAATATTTCGTTGG
TGAGACTAGAACTGTAGATGTTCATATTGGAACTTTGCGTACAAAGCTTGGCGATGCTAGTCACTTGATCAAAACCATTC
GTGGCGTGGGCTACCGATTGGAGGAAGAAAATGGTTAA

Protein sequence :
MIYCVEDDDDIRELMLYTLKTTGFVAQGFPNAELFWQAIESQKPDLILLDIMLPGSDGLSILEELKGKMSTADIPVIMAT
AKGTEFDKVKGLDMGSDDYLVKPFGMMEMISRIKAVLRRSQKSQRKQILQVGNLSLDIQNYTVKKDGKDISLTLKEFELL
GLLMKYPNRVFTRQELLNQVWGEYFVGETRTVDVHIGTLRTKLGDASHLIKTIRGVGYRLEEENG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-24 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-23 43
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 5e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_002952.2859858.p0 Protein 1e-24 45
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_007622.3794948.p0 Protein 1e-24 45
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_003923.1003417.p0 Protein 1e-24 45
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_013450.8614146.p0 Protein 1e-24 45
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_002951.3238224.p0 Protein 1e-24 45
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_007793.3914065.p0 Protein 1e-24 45
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_002758.1121390.p0 Protein 1e-24 45
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_010079.5776364.p0 Protein 1e-24 45
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_012469.1.7686381. Protein 2e-29 44
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator CP004022.1.gene3215. Protein 4e-21 43
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_002952.2859905.p0 Protein 3e-33 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_002745.1124361.p0 Protein 2e-33 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_009782.5559369.p0 Protein 2e-33 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_002951.3237708.p0 Protein 2e-33 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_007622.3794472.p0 Protein 3e-33 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_002758.1121668.p0 Protein 2e-33 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_009641.5332272.p0 Protein 2e-33 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_013450.8614421.p0 Protein 2e-33 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_007793.3914279.p0 Protein 2e-33 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator NC_003923.1003749.p0 Protein 3e-33 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator AE016830.1.gene2255. Protein 2e-24 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator U35369.1.gene1.p01 Protein 2e-24 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator AE015929.1.gene1106. Protein 2e-20 42
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator HE999704.1.gene1202. Protein 1e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator VFG0596 Protein 3e-24 44
phoB YP_006034757.1 OmpR family two component system phosphate regulon response regulator VFG1389 Protein 6e-27 42