Gene Information

Name : RSPO_m00642 (RSPO_m00642)
Accession : YP_006031816.1
Strain :
Genome accession: NC_017575
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with cops, regulation of copper resistance
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 723887 - 724567 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence :
ATGAACATTCTCGTCATTGAAGACGACGCCCGCGTCTCGGATTTCCTCTCGCGCGGCCTGCGGGCCGAGGGCTATCGCGT
GCTGCTCGCGCGCACCGGCCCCGAGGGCCTGCAACTGGCCCGCACCGGCGAGCCGGCGCTGCTGCTGCTCGACCTGATGC
TGCCCGGCATGAGCGGCCTGGAGCTGTGCCAGACCCTGCGCGCGGAGCGCAACCATGTGCCGATCCTGATGCTCACGTCG
CTGACCGACATCGACGATCGGGTCACCGGCCTGCGGCTGGGCGCGGACGACTACATGACCAAGCCCTTCGCGTTCGAGGA
ACTGCTCGCGCGCATCGAGGCGCTGCTGCGCCGCGGGCGCGAGCAGCGGCCGAAGGTCAATGTGCTGCAGGTGGCCGACC
TCGTGCTCGACCGCGAGCGCATGCAGGTCACCCGGGCCGGCAAGCCCATCCCGCTCACGGCCAAGGAGCTGGCCTTCCTG
GAGCTGCTGATGAGCGCGCCCGGCCGCATCTACAGCCGCGAGCGCATCCTGTCGAACGTCTGGGGCGCCAACGAGGATCC
GCTGACCAACATCGTGGATGTCTACGTGCGCCGTCTGCGCAGCAAGATCGACGAAGGCCATCCGGTACCCCTGCTCAAGA
CCGTGCGCGGGCTCGGCTATCGGCTCGATAGCGAGCCCTGA

Protein sequence :
MNILVIEDDARVSDFLSRGLRAEGYRVLLARTGPEGLQLARTGEPALLLLDLMLPGMSGLELCQTLRAERNHVPILMLTS
LTDIDDRVTGLRLGADDYMTKPFAFEELLARIEALLRRGREQRPKVNVLQVADLVLDRERMQVTRAGKPIPLTAKELAFL
ELLMSAPGRIYSRERILSNVWGANEDPLTNIVDVYVRRLRSKIDEGHPVPLLKTVRGLGYRLDSEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-27 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-26 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSPO_m00642 YP_006031816.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0083 Protein 2e-29 47
RSPO_m00642 YP_006031816.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0197 Protein 4e-27 47
RSPO_m00642 YP_006031816.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0638 Protein 4e-23 47
RSPO_m00642 YP_006031816.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0111 Protein 7e-32 46
RSPO_m00642 YP_006031816.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0308 Protein 3e-28 46
RSPO_m00642 YP_006031816.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0347 Protein 1e-26 45
RSPO_m00642 YP_006031816.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0125 Protein 2e-30 44
RSPO_m00642 YP_006031816.1 response regulator in two-component regulatory system with cops, regulation of copper resistance HE999704.1.gene1528. Protein 2e-25 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSPO_m00642 YP_006031816.1 response regulator in two-component regulatory system with cops, regulation of copper resistance VFG0596 Protein 2e-27 45
RSPO_m00642 YP_006031816.1 response regulator in two-component regulatory system with cops, regulation of copper resistance VFG1390 Protein 2e-29 44