Gene Information

Name : vicR (SPSE_0024)
Accession : YP_006014213.1
Strain : Staphylococcus pseudintermedius ED99
Genome accession: NC_017568
Putative virulence/resistance : Virulence
Product : two-component response regulator VicR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 26392 - 27093 bp
Length : 702 bp
Strand : +
Note : identified by match to protein family HMM PF00072, match to protein family HMM PF00486

DNA sequence :
ATGGCAAGAAAAGTAGTCGTAGTCGATGATGAAAAACCAATTGCGGATATATTAGAATTTAATTTGAAAAAAGAAGGTTA
TGAAGTATTTGTCGCATATGATGGCAACGATGCGGTCGACTTAATCTATGAAAAAGAACCTGATATCGTGTTACTCGATA
TTATGTTGCCTGGCCAAGACGGTATGGAAGTGTGCCGTGAAGTGCGTAAAAAATTCGAAATGCCAATTATTATGTTGACG
GCTAAAGACTCAGAGATCGATAAAGTCCTCGGTCTTGAGCTTGGTGCGGATGACTATGTGACAAAACCATTTAGTACGCG
TGAATTAATTGCACGTGTGAAAGCTAACTTACGCCGCCATTATACACAACCGAGTCAAGAAAATCACATGCAGACGAATG
AAATTACAATTAAAGATATTGTGATTTATCCAGATGCTTATTCTATTAAAAAACGCGGTGAAGATATTGATTTGACGCAC
CGTGAATTTGAGTTGTTCCATTATTTATCGAAACATATGGGACAAGTGATGACGCGTGAACATTTGCTCCAAACGGTATG
GGGTTATGATTATTTCGGTGATGTCCGTACTGTAGACGTTACGATTCGCCGTTTACGTGAAAAAATTGAAGATGATCCTT
CTCATCCAGACTATATTGTGACGCGTCGTGGTGTTGGATATTTCTTACAACAACATGATTAG

Protein sequence :
MARKVVVVDDEKPIADILEFNLKKEGYEVFVAYDGNDAVDLIYEKEPDIVLLDIMLPGQDGMEVCREVRKKFEMPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYTQPSQENHMQTNEITIKDIVIYPDAYSIKKRGEDIDLTH
REFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPDYIVTRRGVGYFLQQHD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-37 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_006014213.1 two-component response regulator VicR NC_012469.1.7685629. Protein 3e-70 63
vicR YP_006014213.1 two-component response regulator VicR NC_002952.2859905.p0 Protein 4e-55 52
vicR YP_006014213.1 two-component response regulator VicR NC_003923.1003749.p0 Protein 4e-55 52
vicR YP_006014213.1 two-component response regulator VicR NC_007622.3794472.p0 Protein 3e-55 52
vicR YP_006014213.1 two-component response regulator VicR NC_002745.1124361.p0 Protein 4e-55 52
vicR YP_006014213.1 two-component response regulator VicR NC_009782.5559369.p0 Protein 4e-55 52
vicR YP_006014213.1 two-component response regulator VicR NC_002951.3237708.p0 Protein 4e-55 52
vicR YP_006014213.1 two-component response regulator VicR NC_002758.1121668.p0 Protein 4e-55 52
vicR YP_006014213.1 two-component response regulator VicR NC_009641.5332272.p0 Protein 4e-55 52
vicR YP_006014213.1 two-component response regulator VicR NC_013450.8614421.p0 Protein 4e-55 52
vicR YP_006014213.1 two-component response regulator VicR NC_007793.3914279.p0 Protein 4e-55 52
vicR YP_006014213.1 two-component response regulator VicR HE999704.1.gene2815. Protein 9e-51 49
vicR YP_006014213.1 two-component response regulator VicR NC_012469.1.7686381. Protein 6e-47 48
vicR YP_006014213.1 two-component response regulator VicR AE016830.1.gene1681. Protein 2e-48 46
vicR YP_006014213.1 two-component response regulator VicR NC_014475.1.orf0.gen Protein 2e-43 45
vicR YP_006014213.1 two-component response regulator VicR NC_005054.2598277.p0 Protein 2e-43 45
vicR YP_006014213.1 two-component response regulator VicR AE000516.2.gene3505. Protein 4e-42 45
vicR YP_006014213.1 two-component response regulator VicR AF130997.1.orf0.gene Protein 7e-43 44
vicR YP_006014213.1 two-component response regulator VicR AM180355.1.gene1830. Protein 5e-46 44
vicR YP_006014213.1 two-component response regulator VicR FJ349556.1.orf0.gene Protein 2e-40 43
vicR YP_006014213.1 two-component response regulator VicR AF155139.2.orf0.gene Protein 1e-38 43
vicR YP_006014213.1 two-component response regulator VicR HE999704.1.gene1528. Protein 2e-35 42
vicR YP_006014213.1 two-component response regulator VicR NC_010079.5776364.p0 Protein 6e-36 41
vicR YP_006014213.1 two-component response regulator VicR NC_002952.2859858.p0 Protein 6e-36 41
vicR YP_006014213.1 two-component response regulator VicR NC_007622.3794948.p0 Protein 6e-36 41
vicR YP_006014213.1 two-component response regulator VicR NC_003923.1003417.p0 Protein 6e-36 41
vicR YP_006014213.1 two-component response regulator VicR NC_013450.8614146.p0 Protein 6e-36 41
vicR YP_006014213.1 two-component response regulator VicR NC_002951.3238224.p0 Protein 6e-36 41
vicR YP_006014213.1 two-component response regulator VicR NC_007793.3914065.p0 Protein 6e-36 41
vicR YP_006014213.1 two-component response regulator VicR NC_002758.1121390.p0 Protein 6e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_006014213.1 two-component response regulator VicR VFG1702 Protein 6e-38 42
vicR YP_006014213.1 two-component response regulator VicR VFG1563 Protein 4e-38 41