Gene Information

Name : Sput200_3756 (Sput200_3756)
Accession : YP_006011596.1
Strain : Shewanella putrefaciens 200
Genome accession: NC_017566
Putative virulence/resistance : Resistance
Product : mercuric transport periplasmic protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4257543 - 4257818 bp
Length : 276 bp
Strand : -
Note : KEGG: shw:Sputw3181_3207 mercuric transport protein periplasmic component; TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein

DNA sequence :
ATGAAGAAAATCACCTTGTTGTTTTTGCTAACGTTGACCAGCCTGAGCGCTATAGCCGAAACGAAAACGGTTACGTTGGA
AGTTCCGACCATGAACTGCGTCACTTGTCCGTTTACGGTCAAAAAAGCCTTACAAAATGTCGAGGGCGTCAGTAAAGCTG
AAGTCACCTTTGACACCAAGTTAGCAGTAGTCACCTTCGATGACGAAAAAACCACGGTGAAAGCACTGACTGAAGCCACC
ACTAACGCGGGTTATCCGTCAACGGTCAAAGAGTAA

Protein sequence :
MKKITLLFLLTLTSLSAIAETKTVTLEVPTMNCVTCPFTVKKALQNVEGVSKAEVTFDTKLAVVTFDDEKTTVKALTEAT
TNAGYPSTVKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-17 65
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-17 65
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 8e-18 65
merP AFG30122.1 MerP Not tested PAGI-2 Protein 8e-18 64
merP AGK07023.1 MerP Not tested SGI1 Protein 8e-18 64
merP AGK07081.1 MerP Not tested SGI1 Protein 8e-18 64
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-17 64
merP ABQ57373.1 MerP Not tested SGI1 Protein 8e-18 64
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 8e-18 64
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 4e-18 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sput200_3756 YP_006011596.1 mercuric transport periplasmic protein BAC0675 Protein 7e-19 69
Sput200_3756 YP_006011596.1 mercuric transport periplasmic protein BAC0231 Protein 1e-17 68
Sput200_3756 YP_006011596.1 mercuric transport periplasmic protein BAC0678 Protein 1e-18 67
Sput200_3756 YP_006011596.1 mercuric transport periplasmic protein BAC0679 Protein 4e-18 67
Sput200_3756 YP_006011596.1 mercuric transport periplasmic protein BAC0674 Protein 1e-15 54