Gene Information

Name : Sput200_3027 (Sput200_3027)
Accession : YP_006010893.1
Strain : Shewanella putrefaciens 200
Genome accession: NC_017566
Putative virulence/resistance : Unknown
Product : ISSpu17 transposase, TnpA_ISSpu17
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3423403 - 3424095 bp
Length : 693 bp
Strand : +
Note : KEGG: sbp:Sbal223_4345 transposase and inactivated derivatives-like protein

DNA sequence :
ATGTCGCTAAACTTTTCTGGACGCCATTTCCCAACAGATATCATCATGCAAGCCCTACGATATTACCTGGCCTATAAACT
GAGTTACCGTGAAATTGAGGAGATGTTCGCTGAACGTAATATCCATTTTGACCACTCAACACTGAACCGTTGGGTTATCA
AATATGCGCCGCAACTCGAAGCCGTATTCAGGAAGAGAAAGCGTCGAGTATCAGGGTCGTGGCGAATGGACGAAACCTAC
ATAAAGATTAAAGGTCGCTGGGTTTACTATTATCACGCCGTGGATAAATACGGTGCTATTATTGATTTTTATTTGAGTGA
GACCCGTGATGAACCTGCTGCTCGGGCGTTTTTCAATAAAGCTATCAACCAACATGGCTTACCTGGAAAGGTCGTCATTG
ATCAAAGTGGGGCGAATGCTGCGGCATTAGACACCATTAATATTCGTCTTTGGCTGTCTGGTTGCATGTTGTTTATGATT
GAGGTTTTAGCCATAAAATATCTGAATAATATTGTTGAGCAAAGTCATCGAAAAGTGAAAGGTAAAATGCATCAATGTTT
GGGTTGGAAGTCTTGGGAAGGTGCCGAATCAACGCTTGCTGGCGTTGAACTTTGGTTCATGATAAAGCAAGGGCAAATGA
ACACCACCGAAAAGATGACACCATGGGAACAATTTTATTCTTTAGCCGCATAA

Protein sequence :
MSLNFSGRHFPTDIIMQALRYYLAYKLSYREIEEMFAERNIHFDHSTLNRWVIKYAPQLEAVFRKRKRRVSGSWRMDETY
IKIKGRWVYYYHAVDKYGAIIDFYLSETRDEPAARAFFNKAINQHGLPGKVVIDQSGANAAALDTINIRLWLSGCMLFMI
EVLAIKYLNNIVEQSHRKVKGKMHQCLGWKSWEGAESTLAGVELWFMIKQGQMNTTEKMTPWEQFYSLAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tnpA6100 ACN62081.1 TnpA6100 Not tested SGI1 Protein 1e-26 42
tnpA6100 ACN81001.1 transposase Not tested AbaR5 Protein 1e-26 42
tpnIS26 ADZ05778.1 transposase Not tested AbaR12 Protein 5e-26 41
tpnIS26 ADZ05794.1 transposase Not tested AbaR16 Protein 5e-26 41
tnpA26 ACN81018.1 transposase of IS26 Not tested AbaR5 Protein 2e-25 41
tnpA26 ACV89829.1 transposase of IS26 Not tested AbaR6 Protein 5e-26 41
tnpA26 AGK07097.1 IS26 transposase Not tested SGI1 Protein 1e-25 41
tpnIS26 ADZ05800.1 transposase Not tested AbaR19 Protein 1e-25 41
tnpA26 ACN81013.1 transposase of IS26 Not tested AbaR5 Protein 2e-25 41
tnp26 AGK36639.1 transposase of IS26 Not tested AbaR26 Protein 5e-26 41
tnpA26 ACV89831.1 transposase of IS26 Not tested AbaR7 Protein 5e-26 41
tnpA26 AFV53107.1 transposase of IS26 Not tested AbGRI2-1 Protein 1e-25 41
tnpA AET25383.1 TnpA Not tested PAGI-2(C) Protein 1e-25 41
tnpA26 ADK35781.1 transposase of IS26 Not tested AbaR8 Protein 5e-26 41
tnpA26 AFV53108.1 transposase of IS26 Not tested AbGRI2-1 Protein 1e-25 41
tnpA AFG30106.1 TnpA Not tested PAGI-2 Protein 1e-25 41
tpnIS26 ADZ05796.1 transposase Not tested AbaR17 Protein 5e-26 41
tnpA26 AFV53110.1 transposase of IS26 Not tested AbGRI2-1 Protein 1e-25 41
tnpA26 AGK07034.1 IS26 transposase Not tested SGI1 Protein 1e-25 41
tpnIS26 ADZ05798.1 transposase Not tested AbaR18 Protein 5e-26 41
tnpA26 AFV53122.1 transposase of IS26 Not tested AbGRI2-1 Protein 1e-25 41
tnpA26 AGK07037.1 IS26 transposase Not tested SGI1 Protein 1e-25 41
Pmu_03480 YP_005176246.1 IS26 transposase Not tested ICEPmu1 Protein 8e-26 41
tpnIS26 ADZ05810.1 transposase Not tested AbaR20 Protein 5e-26 41
tnpA26 AGK07039.1 IS26 transposase Not tested SGI1 Protein 1e-25 41
tnpA26 ACK44541.1 TnpA Not tested SGI1 Protein 1e-25 41
tnpA26 ACN81016.1 transposase of IS26 Not tested AbaR5 Protein 8e-26 41
tnpA26 AFV53109.1 transposase of IS26 Not tested AbGRI2-1 Protein 5e-26 41
tnpA26 AGK07092.1 IS26 transposase Not tested SGI1 Protein 1e-25 41
tnpA26 ACK44543.1 TnpA Not tested SGI1 Protein 1e-25 41
Pmu_03450 YP_005176243.1 IS26 transposase Not tested ICEPmu1 Protein 2e-25 41
tnp26 AGK36641.1 transposase of IS26 Not tested AbaR26 Protein 5e-26 41
tnpA26 AGK07095.1 IS26 transposase Not tested SGI1 Protein 1e-25 41
tpnIS26 ADZ05788.1 transposase Not tested AbaR15 Protein 1e-25 41
ABTW07_3890 YP_005797138.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 7e-26 41
ABTW07_3906 YP_005797154.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 7e-26 41
tnp7109-28 YP_001800928.1 transposase for insertion sequence Not tested Not named Protein 2e-25 41
IS26 CAJ77078.1 Insertion sequence Not tested AbaR1 Protein 5e-26 41
tnp7109-29 YP_001800930.1 transposase for insertion sequence Not tested Not named Protein 2e-25 41
unnamed AEZ06025.1 TnpA26, Transposase of IS26 Not tested AbaR24 Protein 1e-25 41
ABTW07_3872 YP_005797120.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 7e-26 41
ABTW07_3875 YP_005797123.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 7e-26 41
IS26 CAJ77074.1 Insertion sequence Not tested AbaR1 Protein 1e-25 41
tnp YP_252008.1 transposase for IS431mec Not tested SCCmec Protein 2e-26 41
ef0041 AAM75240.1 EF0034 Not tested Not named Protein 2e-23 41