Gene Information

Name : Sput200_0225 (Sput200_0225)
Accession : YP_006008179.1
Strain : Shewanella putrefaciens 200
Genome accession: NC_017566
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator for periplasmic stress, CpxR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 244079 - 244765 bp
Length : 687 bp
Strand : -
Note : KEGG: shw:Sputw3181_0217 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence : 
ATGAGTCGGATATTATTGATCGATGACGATCTCGGTTTATCGGAATTACTCGGGCAGTTGCTTGAACTGGAAGGCTTTAC
CTTAACGTTAGCCTACGATGGTAAGAAAGGATTAGATCTTGCCCTCACAACCGATTTTGATCTGATTTTACTCGATGTCA
TGTTACCTAAATTAAATGGTTTTGAAGTGCTTCGAGCCCTGCGCCAACATAAACAAACTCCTGTATTGATGCTAACAGCC
CGTGGCGATGAAATAGACCGCGTTGTGGGTCTTGAAATTGGCGCTGATGACTACCTGCCAAAACCCTTTAATGACCGAGA
GTTAATCGCCCGTATTCGTGCAATTATCCGCCGTGCCCATTTAACCGCCCAAGAAATTCATGCGGCGCCAGCCCAAGAGT
TTGGCGATTTGCGTTTAGACCCTTCACGCCAAGAAGCCTACTGTAATGAACAACTGATTATTCTTACGGGAACAGAGTTC
ACGCTATTGCATACCCTAGCATTACACGCTGGTGAGTTAATGAATAAAGAAGAGCTAAATGAAATTGTGCTTGGCAAAAA
ACTTATGCCCTTCGATCGCAGTTTAGATATGCACCTGTCCAATTTACGGAAAAAGCTCCCCGAGCGTAGCGATGGCAGAC
CGAGGGTAAAAACCATCCGAGGTAAAGGTTATATCTGGCTACCATAA

Protein sequence : 
MSRILLIDDDLGLSELLGQLLELEGFTLTLAYDGKKGLDLALTTDFDLILLDVMLPKLNGFEVLRALRQHKQTPVLMLTA
RGDEIDRVVGLEIGADDYLPKPFNDRELIARIRAIIRRAHLTAQEIHAAPAQEFGDLRLDPSRQEAYCNEQLIILTGTEF
TLLHTLALHAGELMNKEELNEIVLGKKLMPFDRSLDMHLSNLRKKLPERSDGRPRVKTIRGKGYIWLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR CP001138.1.gene4273. Protein 7e-44 62
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR CP001918.1.gene5135. Protein 2e-43 61
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR BAC0533 Protein 2e-43 61
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR NC_002695.1.915041.p Protein 2e-43 61
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR CP000647.1.gene4257. Protein 2e-43 61
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR CP000034.1.gene3834. Protein 2e-43 61
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR CP001485.1.gene721.p Protein 3e-45 59
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR CP004022.1.gene3215. Protein 1e-45 58
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR CP000675.2.gene1535. Protein 1e-37 54
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR HE999704.1.gene2815. Protein 2e-26 43
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR NC_012469.1.7686381. Protein 6e-27 41
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR NC_008702.1.4607594. Protein 8e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sput200_0225 YP_006008179.1 two component transcriptional regulator for periplasmic stress, CpxR VFG0596 Protein 9e-24 41