Gene Information

Name : Y11_p0491 (Y11_p0491)
Accession : YP_006007897.1
Strain :
Genome accession: NC_017565
Putative virulence/resistance : Unknown
Product : transposase and inactivated derivatives
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 33287 - 33556 bp
Length : 270 bp
Strand : +
Note : -

DNA sequence :
TTGAGGCTCGCCCAGCTTGTACTCGAGCAGCATTACACCGTTGCCGCCGCTGCCACTGCGATGAATGTCGGCAAATCCAC
GATGAATAAATGGGTTCGACAACTGAAAGAAGAACGAGCGGGAAAATCACCCATAGCTTCACCCATGACACCTGAGCAGA
TTGAGATACGTGAGTTGAAGAAAAGACTTCAACGCGTTGAAATGGAAAGGGATATATTAAAAAAGGCTACCGCGCTCTTG
ATGTCAGACTCCCTGAACAATTTTCATTAG

Protein sequence :
MRLAQLVLEQHYTVAAAATAMNVGKSTMNKWVRQLKEERAGKSPIASPMTPEQIEIRELKKRLQRVEMERDILKKATALL
MSDSLNNFH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 5e-28 79
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-27 79
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-27 79
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-27 79
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-27 79
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-27 79
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-27 79
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-27 79
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-27 79
api80 CAF28554.1 putative transposase Not tested YAPI Protein 4e-23 73
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-26 73
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-26 73
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-21 64
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 1e-16 56
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-16 56
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-16 56
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-16 56
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-18 56
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 5e-18 56
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-15 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Y11_p0491 YP_006007897.1 transposase and inactivated derivatives VFG1123 Protein 1e-27 79
Y11_p0491 YP_006007897.1 transposase and inactivated derivatives VFG1485 Protein 4e-27 73
Y11_p0491 YP_006007897.1 transposase and inactivated derivatives VFG1553 Protein 6e-22 64
Y11_p0491 YP_006007897.1 transposase and inactivated derivatives VFG0784 Protein 5e-17 56