Gene Information

Name : PAGR_g3965 (PAGR_g3965)
Accession : YP_005994670.1
Strain : Pantoea ananatis PA13
Genome accession: NC_017554
Putative virulence/resistance : Resistance
Product : ultiple antibiotic resistance protein MarA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4309375 - 4309743 bp
Length : 369 bp
Strand : -
Note : -

DNA sequence :
ATGAATCAGCGCGAGTTTATTCGTAGTTTGCTGGAATGGATAGAAAGCAATTTAGGACACGATCTGCATCTGGACGAAGT
TGCTCGCCGCGCGGGCTATTCCCGTTGGCACCTGCAACGGTTATTTCGCCAGCATACCGGCTTCTCACTGGCCGAGTATA
TCCGTCAGCGCCGTCTGACCGAGTCGGCCCTGACGCTGCTTAACAGCAACGAAGCCATTTTACAGGTGGCGATGAGCTAT
GGGTTTGATACCCAACAGGCCTACACACGAACGTTTAAAAACTATTTTATGGTCACGCCGGGTCAACTTCGCCGTCAGCG
CCGGGTAGAGCCAGATCGTTTATTATTCCCTTATGCCATGGCAAGTTAG

Protein sequence :
MNQREFIRSLLEWIESNLGHDLHLDEVARRAGYSRWHLQRLFRQHTGFSLAEYIRQRRLTESALTLLNSNEAILQVAMSY
GFDTQQAYTRTFKNYFMVTPGQLRRQRRVEPDRLLFPYAMAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-22 51
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-22 51
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 4e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA CP000647.1.gene1624. Protein 2e-24 54
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA CP001918.1.gene2033. Protein 1e-25 54
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA NC_002695.1.917339.p Protein 5e-25 53
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA BAC0560 Protein 5e-25 53
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA CP000034.1.gene1596. Protein 4e-25 53
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA CP001138.1.gene1637. Protein 1e-24 52
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA NC_010558.1.6276025. Protein 6e-23 51
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA CP001138.1.gene612.p Protein 2e-22 43
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA CP001138.1.gene4488. Protein 1e-20 41
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA CP001918.1.gene327.p Protein 3e-20 41
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA CP000647.1.gene4499. Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA VFG1038 Protein 6e-23 51
PAGR_g3965 YP_005994670.1 ultiple antibiotic resistance protein MarA VFG0585 Protein 1e-20 41