Gene Information

Name : PAGR_g2270 (PAGR_g2270)
Accession : YP_005992999.1
Strain : Pantoea ananatis PA13
Genome accession: NC_017554
Putative virulence/resistance : Resistance
Product : multiple antibiotic resistance protein MarA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2461945 - 2462292 bp
Length : 348 bp
Strand : -
Note : -

DNA sequence : 
ATGATGAGTAACGCTTTTATTCACGACCTGATTAGCTGGATCGATAACAATATCGAAGCACGTCTCGATCTCGACACTGT
TTCTGAGCGCGCTGGCTATTCAAAATGGCACCTGCAACGGATGTTTAAAGAGCACACCGGCTATCCACTGGGTGAATACA
TTCGCATGAAGAAGCTGAAAAAATCGGCCGACCGTCTGACCAGCACCAACGAGCCTATCCTGAATGTAGCGATATCGCTG
GGATTTGACTCGCAACAGTCTTTTAACCGCAGCTTTAAGCGTCAGTACGGTGTTGCCCCGGGTGCATGGCGCCGTCACAC
TGTGCCTTCGCAGTCAGCCATGCAGTAA

Protein sequence : 
MMSNAFIHDLISWIDNNIEARLDLDTVSERAGYSKWHLQRMFKEHTGYPLGEYIRMKKLKKSADRLTSTNEPILNVAISL
GFDSQQSFNRSFKRQYGVAPGAWRRHTVPSQSAMQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 9e-20 46
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 9e-20 46
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 5e-22 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA CP000647.1.gene1624. Protein 2e-26 53
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA CP001918.1.gene2033. Protein 2e-26 52
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA NC_002695.1.917339.p Protein 3e-25 50
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA CP001138.1.gene1637. Protein 4e-25 50
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA BAC0560 Protein 3e-25 50
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA CP000034.1.gene1596. Protein 2e-25 50
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA NC_010558.1.6276025. Protein 4e-20 46
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA BAC0371 Protein 4e-23 45
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA NC_002695.1.914293.p Protein 4e-23 45
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA CP001138.1.gene4488. Protein 2e-22 44
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA CP000034.1.gene4505. Protein 9e-23 44
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA CP001918.1.gene327.p Protein 1e-22 44
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA CP001138.1.gene612.p Protein 3e-21 42
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA CP000647.1.gene4499. Protein 9e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA VFG1038 Protein 4e-20 46
PAGR_g2270 YP_005992999.1 multiple antibiotic resistance protein MarA VFG0585 Protein 1e-22 44