Gene Information

Name : rpmJ (NCGM2_5487)
Accession : YP_005983693.1
Strain : Pseudomonas aeruginosa NCGM2.S1
Genome accession: NC_017549
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L36
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5883197 - 5883313 bp
Length : 117 bp
Strand : -
Note : similar to GI:116052277; similar to PA14_09070 of P. aeruginosa UCBPP-PA14

DNA sequence :
ATGAAAGTTCGTGCATCGGTCAAGAAGCTGTGCCGTAACTGCAAAATCATCCGTCGCGATGGCATCGTGCGGGTGATCTG
CAGCGCGGAACCGCGTCACAAGCAGCGCCAAGGCTGA

Protein sequence :
MKVRASVKKLCRNCKIIRRDGIVRVICSAEPRHKQRQG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmJ YP_001800879.1 50S ribosomal protein L36 Not tested Not named Protein 0.54 45