Gene Information

Name : copR (NCGM2_3903)
Accession : YP_005982129.1
Strain : Pseudomonas aeruginosa NCGM2.S1
Genome accession: NC_017549
Putative virulence/resistance : Virulence
Product : putative two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4238093 - 4238779 bp
Length : 687 bp
Strand : +
Note : similar to GI:116050809; similar to PA14_27810 of P. aeruginosa UCBPP-PA14

DNA sequence :
ATGAACATGAAACTGCTGATCGTCGAAGACGAACCGCGCATCGGCCAGTACCTGCGCCAGGGGCTCGCCGAGGCAGGCTT
CGCCGTCGACCTGAGCGACGATGGCAACGAGGGCGAGCAACTGGCCCTGGGCGGCGACTACGACCTGCTGATCCTCGACG
TCATGCTGCCCGGCCGTGACGGCTGGCAGATCCTGCGCAGCGTGCGCGACGCCGGGATGACCATACCGGTGCTGTTCCTG
ACCGCCCGCGATGCCGTAGAGGACCGCGTGCGCGGCCTCGAACAAGGCGCCGACGATTACCTGGTGAAGCCGTTCGCCTT
CGTCGAACTGCTCGCCCGGGTGCGCACCCTGCTGCGCCGGGGCAGCCAGCAGTTGCAGGAGACCACCCTGCAACTGGCCG
ACCTCGAACTCGATTTGCTGCGCCGCCGGGTGCAACGCCAGGGCAAGCGGATCGACCTCACCGCCAAGGAGTTCGCCCTG
CTCGAACTGCTGCTGCGGCGCAGCGGCGAGGTGCTGCCCAAGTCGCTGATCGCCTCGCAGGTCTGGGACATGAACTTCGA
CAGCGATACCAACGTCATCGAGGTGGCCATCCGCCGCCTGCGCGCCAAGGTCGACGACGACTACCCGCAGCGCCTGATCC
ATACCGTGCGCGGCATGGGCTACGTTCTCGAAGAGCGCGACGAATGA

Protein sequence :
MNMKLLIVEDEPRIGQYLRQGLAEAGFAVDLSDDGNEGEQLALGGDYDLLILDVMLPGRDGWQILRSVRDAGMTIPVLFL
TARDAVEDRVRGLEQGADDYLVKPFAFVELLARVRTLLRRGSQQLQETTLQLADLELDLLRRRVQRQGKRIDLTAKEFAL
LELLLRRSGEVLPKSLIASQVWDMNFDSDTNVIEVAIRRLRAKVDDDYPQRLIHTVRGMGYVLEERDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-52 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-51 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_005982129.1 putative two-component response regulator BAC0638 Protein 5e-61 72
copR YP_005982129.1 putative two-component response regulator BAC0083 Protein 9e-67 71
copR YP_005982129.1 putative two-component response regulator BAC0111 Protein 4e-64 64
copR YP_005982129.1 putative two-component response regulator BAC0308 Protein 9e-61 62
copR YP_005982129.1 putative two-component response regulator BAC0197 Protein 2e-58 60
copR YP_005982129.1 putative two-component response regulator BAC0347 Protein 2e-56 59
copR YP_005982129.1 putative two-component response regulator BAC0125 Protein 4e-58 59
copR YP_005982129.1 putative two-component response regulator BAC0487 Protein 2e-26 42
copR YP_005982129.1 putative two-component response regulator NC_002516.2.879194.p Protein 5e-25 42
copR YP_005982129.1 putative two-component response regulator HE999704.1.gene1528. Protein 3e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_005982129.1 putative two-component response regulator VFG0596 Protein 1e-52 57
copR YP_005982129.1 putative two-component response regulator VFG1390 Protein 9e-37 46
copR YP_005982129.1 putative two-component response regulator VFG1389 Protein 2e-28 42
copR YP_005982129.1 putative two-component response regulator VFG0473 Protein 1e-27 41