Gene Information

Name : merD (NCGM2_1749)
Accession : YP_005979995.1
Strain : Pseudomonas aeruginosa NCGM2.S1
Genome accession: NC_017549
Putative virulence/resistance : Resistance
Product : transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1886838 - 1887200 bp
Length : 363 bp
Strand : -
Note : similar to AA sequence:ISND:P_052886; similar to transcriptional regulator MerD [Plasmid R100]

DNA sequence :
ATGAGCGCCTACACGGTATCGCAACTGGCCCATAACGCTGGGGTGAGCGTACATATCGTGCGCGACTACCTGGTGCGCGG
CTTGTTACGGCCGGTGGCCTGCACCACGGGCGGCTACGGCGTGTTCGACGATGCGGCCTTGCAACGGCTGTGCTTCGTGC
GCGCGGCCTTCGAGGCGGGTATCGGCCTGGATGCCCTGGCGCGGCTGTGCCGTGCGCTCGACGCAGCGGACGGCGCACAA
GCCGCAGCGCAGCTTGCCGTGCTGCGCCAGTTGGTCGAGCGGCGGCGCGCGGCGTTGGCCCATCTGGACGCGCAACTGGC
CTCCATGCCAGCCGAGCGGGCGCACGAGGAGGCATTGCCGTGA

Protein sequence :
MSAYTVSQLAHNAGVSVHIVRDYLVRGLLRPVACTTGGYGVFDDAALQRLCFVRAAFEAGIGLDALARLCRALDAADGAQ
AAAQLAVLRQLVERRRAALAHLDAQLASMPAERAHEEALP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merD ACF06181.1 mercuric resistance protein Not tested Tn5036-like Protein 8e-32 100
merD AET25396.1 MerD Not tested PAGI-2(C) Protein 8e-32 100
merD AFG30119.1 MerD Not tested PAGI-2 Protein 8e-32 100
merD YP_006098386.1 MerR family transcriptional regulator Not tested Tn2411 Protein 1e-31 100
merD ACN81004.1 MerD Not tested AbaR5 Protein 5e-24 83
merD CAJ77059.1 Mercury operon coregulator protein Not tested AbaR1 Protein 6e-24 83
merD AGK07020.1 MerD Not tested SGI1 Protein 2e-25 82
merD AGK07078.1 MerD Not tested SGI1 Protein 2e-25 82
merD ABQ57370.1 MerD Not tested SGI1 Protein 4e-25 81

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merD YP_005979995.1 transcriptional regulator BAC0666 Protein 8e-26 83
merD YP_005979995.1 transcriptional regulator BAC0668 Protein 9e-26 82
merD YP_005979995.1 transcriptional regulator BAC0665 Protein 3e-26 82
merD YP_005979995.1 transcriptional regulator BAC0667 Protein 1e-26 81
merD YP_005979995.1 transcriptional regulator BAC0227 Protein 2e-25 81
merD YP_005979995.1 transcriptional regulator BAC0669 Protein 1e-25 76