Gene Information

Name : NCGM2_1450 (NCGM2_1450)
Accession : YP_005979701.1
Strain : Pseudomonas aeruginosa NCGM2.S1
Genome accession: NC_017549
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1593264 - 1593476 bp
Length : 213 bp
Strand : -
Note : similar to GI:218891435; similar to PLES_27091 of P. aeruginosa LEBS58

DNA sequence :
ATGTCGCAAACACCTGTACTGCAGCCAAACGAGCGCCGCATCCTGCGCCTGGAAGAAGTCGAAGCGAAATCCGGTTTCAA
GCGCGCCCACATCTACAACCTGATGAAGAAACGCCAGTTCCCGCAGGCGCTGCGTCTGGGCGTGCGCGCCGTGGGCTGGG
ATTCCATCGAAATCGATCAGTGGATCGACGAGCGCGTCAACAACCGGGCCTGA

Protein sequence :
MSQTPVLQPNERRILRLEEVEAKSGFKRAHIYNLMKKRQFPQALRLGVRAVGWDSIEIDQWIDERVNNRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C109 AAN62202.1 phage-related protein Not tested PAGI-2(C) Protein 8e-27 92
ORF SG104 AAN62325.1 phage-related protein Not tested PAGI-3(SG) Protein 4e-18 73
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 4e-08 44
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 6e-08 44
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 6e-08 44
unnamed CAA21398.1 - Not tested HPI Protein 2e-09 43
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 1e-09 43
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 3e-08 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NCGM2_1450 YP_005979701.1 hypothetical protein VFG1118 Protein 2e-08 44