Gene Information

Name : LMOG_02362 (LMOG_02362)
Accession : YP_005966499.1
Strain : Listeria monocytogenes J0161
Genome accession: NC_017545
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2586112 - 2586834 bp
Length : 723 bp
Strand : -
Note : -

DNA sequence :
ATGGGAAGTACGTTGGTAAAAATTCTTGTAGTTGATGATGAAGCTTCTATTGTTACCTTGCTACAATTTAATATTGAAAA
AGCAGGATTTGAAGTGGTGACAGCTGAAGATGGTAGAACTGGGTATGAGCTCGCTTTGTCCGAAAAGCCAGATTTAATTG
TGCTTGATTTAATGCTTCCTGAGATGGACGGAATCGAAGTAACAAAAAAACTTCGTCAAGATAAAGTAAATGTACCAATT
TTAATGTTAACAGCAAAAGATGAAGAGTTAGATAAAATTATTGGACTTGAACTTGGAGCAGATGATTATATGACTAAGCC
TTTTAGTCCAAGAGAAGTAGTGGCGAGAATTAAAGCTATCCTGCGTCGAACAGAAGGAAAAGCAGAAATAATAGAAGAAT
TAACCGAAGATGTGGAAGCCACTATATTAATTGGTGATTTGAAAATTTTGCCAGATAGTTACGAAGTGTATTTACAAGAT
GATTTACTTGACCTAACACCGAAAGAATTTGAGTTATTATTATTCCTGGCGAATCATCGTGGCAAAGTTTTCTCTAGAGA
CCAATTGCTCGATACTGTCTGGAACTATGATTACGTTGGCGAAACCCGAATTGTAGACGTTCATGTTAGCCATTTGCGCG
ATAAAATCGAACTAGATACGAAACAACCTAAATATATCAAAACAATTCGTGGCTTCGGTTATAAAATGGAGAACGTAAAA
TAA

Protein sequence :
MGSTLVKILVVDDEASIVTLLQFNIEKAGFEVVTAEDGRTGYELALSEKPDLIVLDLMLPEMDGIEVTKKLRQDKVNVPI
LMLTAKDEELDKIIGLELGADDYMTKPFSPREVVARIKAILRRTEGKAEIIEELTEDVEATILIGDLKILPDSYEVYLQD
DLLDLTPKEFELLLFLANHRGKVFSRDQLLDTVWNYDYVGETRIVDVHVSHLRDKIELDTKQPKYIKTIRGFGYKMENVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-41 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-41 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LMOG_02362 YP_005966499.1 two-component system response regulator HE999704.1.gene2815. Protein 4e-109 100
LMOG_02362 YP_005966499.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-68 61
LMOG_02362 YP_005966499.1 two-component system response regulator NC_002952.2859905.p0 Protein 4e-68 60
LMOG_02362 YP_005966499.1 two-component system response regulator NC_002758.1121668.p0 Protein 3e-68 60
LMOG_02362 YP_005966499.1 two-component system response regulator NC_009641.5332272.p0 Protein 3e-68 60
LMOG_02362 YP_005966499.1 two-component system response regulator NC_013450.8614421.p0 Protein 3e-68 60
LMOG_02362 YP_005966499.1 two-component system response regulator NC_007793.3914279.p0 Protein 3e-68 60
LMOG_02362 YP_005966499.1 two-component system response regulator NC_007622.3794472.p0 Protein 4e-68 60
LMOG_02362 YP_005966499.1 two-component system response regulator NC_002745.1124361.p0 Protein 3e-68 60
LMOG_02362 YP_005966499.1 two-component system response regulator NC_009782.5559369.p0 Protein 3e-68 60
LMOG_02362 YP_005966499.1 two-component system response regulator NC_002951.3237708.p0 Protein 3e-68 60
LMOG_02362 YP_005966499.1 two-component system response regulator AE016830.1.gene1681. Protein 3e-69 58
LMOG_02362 YP_005966499.1 two-component system response regulator NC_012469.1.7685629. Protein 6e-55 55
LMOG_02362 YP_005966499.1 two-component system response regulator NC_012469.1.7686381. Protein 4e-60 50
LMOG_02362 YP_005966499.1 two-component system response regulator CP001485.1.gene721.p Protein 5e-36 43
LMOG_02362 YP_005966499.1 two-component system response regulator AF162694.1.orf4.gene Protein 3e-37 43
LMOG_02362 YP_005966499.1 two-component system response regulator AE000516.2.gene3505. Protein 5e-38 43
LMOG_02362 YP_005966499.1 two-component system response regulator CP001918.1.gene5135. Protein 1e-28 42
LMOG_02362 YP_005966499.1 two-component system response regulator EU250284.1.orf4.gene Protein 9e-39 41
LMOG_02362 YP_005966499.1 two-component system response regulator CP004022.1.gene3215. Protein 1e-35 41
LMOG_02362 YP_005966499.1 two-component system response regulator CP001138.1.gene4273. Protein 1e-31 41
LMOG_02362 YP_005966499.1 two-component system response regulator BAC0533 Protein 7e-32 41
LMOG_02362 YP_005966499.1 two-component system response regulator NC_002695.1.915041.p Protein 3e-31 41
LMOG_02362 YP_005966499.1 two-component system response regulator CP000647.1.gene4257. Protein 7e-32 41
LMOG_02362 YP_005966499.1 two-component system response regulator CP000034.1.gene3834. Protein 3e-31 41
LMOG_02362 YP_005966499.1 two-component system response regulator AM180355.1.gene1830. Protein 4e-38 41
LMOG_02362 YP_005966499.1 two-component system response regulator CP004022.1.gene1676. Protein 1e-32 41
LMOG_02362 YP_005966499.1 two-component system response regulator CP001918.1.gene3444. Protein 4e-34 41
LMOG_02362 YP_005966499.1 two-component system response regulator CP000034.1.gene3671. Protein 5e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LMOG_02362 YP_005966499.1 two-component system response regulator VFG1702 Protein 4e-42 42
LMOG_02362 YP_005966499.1 two-component system response regulator VFG1563 Protein 6e-42 42
LMOG_02362 YP_005966499.1 two-component system response regulator VFG1386 Protein 4e-39 42
LMOG_02362 YP_005966499.1 two-component system response regulator VFG1389 Protein 5e-33 42