Gene Information

Name : merP (OCA4_pOC167B00480)
Accession : YP_005952375.1
Strain :
Genome accession: NC_017539
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic componentMerP
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 46796 - 47080 bp
Length : 285 bp
Strand : -
Note : -

DNA sequence :
ATGACAAAGTTCCCCACCTCGCTGGCGCTCGGGTTGCTTATCGTTTCCTCCGGCGGGGCAATGGCGGAGCAACGAACCGT
CACCCTGGTGGTGGACAACATGTACTGCGAAGCCTGTCCTTACATGGTCAAAAAGACCATCGAGAAGGTTTCCGGCGTCT
CAAAAGTCACCGTTTCGTTCAAGGAAAAAACGGCAGTCGTTGTGTTCGATGATGCGCGGGTAGAGGTCAAGGATCTGACG
AATGCGACGACTGGCGCTGGCTTTCCTTCGGTGCCGAAACGCTGA

Protein sequence :
MTKFPTSLALGLLIVSSGGAMAEQRTVTLVVDNMYCEACPYMVKKTIEKVSGVSKVTVSFKEKTAVVVFDDARVEVKDLT
NATTGAGFPSVPKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 3e-13 55
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-13 55
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-13 55
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-13 55
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-13 55
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 5e-13 55
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-13 55
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-13 55
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 1e-12 50
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 4e-12 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merP YP_005952375.1 mercuric transport protein periplasmic componentMerP BAC0679 Protein 1e-14 59
merP YP_005952375.1 mercuric transport protein periplasmic componentMerP BAC0231 Protein 3e-14 58
merP YP_005952375.1 mercuric transport protein periplasmic componentMerP BAC0678 Protein 4e-14 58
merP YP_005952375.1 mercuric transport protein periplasmic componentMerP BAC0675 Protein 4e-13 52
merP YP_005952375.1 mercuric transport protein periplasmic componentMerP BAC0674 Protein 1e-10 42