Gene Information

Name : TIB1ST10_10725 (TIB1ST10_10725)
Accession : YP_005945693.1
Strain : Propionibacterium acnes 6609
Genome accession: NC_017535
Putative virulence/resistance : Virulence
Product : putative two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2286137 - 2286835 bp
Length : 699 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence : 
ATGAGCATGCACATTCTTGTCGTTGACGATGATCGCGCGGTACGAGAATCCCTCGCCCGATCCCTGCAGTACAGCGGCTA
CGAGGTCGATAGCGCCGCCGACGGCGTCGAGGCTCTCGCCCATCTATCCGGAACTCACCCCGACGCCGTCATTATGGACG
TCATGATGCCGCGTCTAGATGGCTTGGAAGCCACCCGGATGTTGCGCAGCAACGGCAATGACGTGCCGATCCTCATCCTC
ACCGCTCGCGATGCTGTCGACGATCGCGTTGACGGCCTAGACGCTGGTGCCGACGATTATATGGTCAAACCGTTCGCCCT
CGACGAACTCCTCGCCCGACTGCGTGCTCTCACGCGGCGTTCCCGCCCCGAGCCGGGTCCGGACGAAGCCCCTGAACACT
TGTCCTTCGCTGACCTCACCCTTGATCCAGCCACCCGCGAGGTCACCCGCGGGAACCGTCGCATCAGTCTGACGCGTACC
GAGTTCGCCTTGCTGACCGTCTTCCTACAAAACCCGGAGAGGGTGCTGGAACGGTCCTGGCTGCTCCATGAAGTGTGGGG
ATTCGACTTCCCGACCACTGCGAACTCCCTTGAGGTGTATATCGGATATTTGCGTCGCAAGACCGAGCACGACTGTGAGG
CGCGTCTCATCCACACCGTCCGCGGCGTCGGGTACGTGCTGCGGGAAGCGAATCCGTGA

Protein sequence : 
MSMHILVVDDDRAVRESLARSLQYSGYEVDSAADGVEALAHLSGTHPDAVIMDVMMPRLDGLEATRMLRSNGNDVPILIL
TARDAVDDRVDGLDAGADDYMVKPFALDELLARLRALTRRSRPEPGPDEAPEHLSFADLTLDPATREVTRGNRRISLTRT
EFALLTVFLQNPERVLERSWLLHEVWGFDFPTTANSLEVYIGYLRRKTEHDCEARLIHTVRGVGYVLREANP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator BAC0125 Protein 3e-32 44
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator BAC0638 Protein 2e-30 43
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator HE999704.1.gene1528. Protein 3e-34 42
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator BAC0083 Protein 1e-34 42
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator BAC0308 Protein 2e-31 41
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator NC_002952.2859905.p0 Protein 2e-32 41
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator NC_009641.5332272.p0 Protein 2e-32 41
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator NC_013450.8614421.p0 Protein 2e-32 41
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator NC_007793.3914279.p0 Protein 2e-32 41
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator NC_007622.3794472.p0 Protein 2e-32 41
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator NC_002745.1124361.p0 Protein 2e-32 41
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator NC_009782.5559369.p0 Protein 2e-32 41
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator NC_002951.3237708.p0 Protein 2e-32 41
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator NC_003923.1003749.p0 Protein 1e-32 41
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator NC_002758.1121668.p0 Protein 2e-32 41
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator AE000516.2.gene3505. Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator VFG1390 Protein 1e-68 69
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator VFG1386 Protein 3e-43 45
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator VFG1389 Protein 5e-41 45
TIB1ST10_10725 YP_005945693.1 putative two-component response regulator VFG0596 Protein 4e-30 41