Gene Information

Name : PSTAA_4056 (PSTAA_4056)
Accession : YP_005940653.1
Strain : Pseudomonas stutzeri DSM 4166
Genome accession: NC_017532
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4356635 - 4357033 bp
Length : 399 bp
Strand : +
Note : -

DNA sequence :
ATGGCCACAGAGCTGACCATTGGCAAGCTGGCAGACGCCGCCGGGGTGAACGTCGAGACGATCCGCTACTACCAGCGACG
CGGGCTGCTGGATGAACCAGCCAAACCCTTGGGTGGCCATCGGCGCTATCCGGTGGACATGGTGAAGCGACTGCGTTTCA
TCAAGCGGGCTCAGGCGCTGGGTTTCACGCTCTCGGAAGTCGGTGGACTGCTGACGCTGGATGAGTCGTGCGCCTGTGCC
GAAACGCGAGCACGGGCTGCACGCAAGCTCGCGTTGATCGAGCAGAAGATGGCCGACTTGGTCGTCATGCAGCAACTGTT
AGGCGAACTGGTGCAGCAATGTGATGCGGGAGACGGCGGAACGATCTGCCCGATCATCGAGGCACTGATCAGAGAGTAA

Protein sequence :
MATELTIGKLADAAGVNVETIRYYQRRGLLDEPAKPLGGHRRYPVDMVKRLRFIKRAQALGFTLSEVGGLLTLDESCACA
ETRARAARKLALIEQKMADLVVMQQLLGELVQQCDAGDGGTICPIIEALIRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 5e-36 64
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 3e-28 54
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-27 53
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-27 53
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-27 53
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-27 53
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-27 53
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-27 53
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-28 53
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 3e-28 53
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 1e-26 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSTAA_4056 YP_005940653.1 MerR family transcriptional regulator BAC0687 Protein 6e-28 53
PSTAA_4056 YP_005940653.1 MerR family transcriptional regulator BAC0688 Protein 7e-29 53
PSTAA_4056 YP_005940653.1 MerR family transcriptional regulator BAC0686 Protein 2e-29 53
PSTAA_4056 YP_005940653.1 MerR family transcriptional regulator BAC0232 Protein 6e-28 53
PSTAA_4056 YP_005940653.1 MerR family transcriptional regulator BAC0689 Protein 2e-27 53
PSTAA_4056 YP_005940653.1 MerR family transcriptional regulator BAC0684 Protein 3e-29 52
PSTAA_4056 YP_005940653.1 MerR family transcriptional regulator BAC0683 Protein 3e-28 51
PSTAA_4056 YP_005940653.1 MerR family transcriptional regulator BAC0682 Protein 7e-21 42