Gene Information

Name : marA (PAJ_3470)
Accession : YP_005936345.1
Strain : Pantoea ananatis AJ13355
Genome accession: NC_017531
Putative virulence/resistance : Resistance
Product : multiple antibiotic resistance protein MarA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4160642 - 4161049 bp
Length : 408 bp
Strand : +
Note : similar to Pantoea sp. At-9b, transcriptional regulator, AraC family (NCBI: ZP_05732327.1) COG: transcription subcellular localization as predicted by Psort 2.0: cytoplasmic

DNA sequence :
GTGTGTTCCCTGCACATCTGCTTTAACCAGGAGAACACCATGAATCAGCGCGAGTTTATTCGTAGTTTGCTGGAATGGAT
AGAAAGCAATTTAGGACACGATCTGCATCTGGACGAAGTTGCTCGCCGCGCGGGCTATTCCCGTTGGCACCTGCAACGGT
TATTTCGCCAGCATACCGGCTTCTCACTGGCCGAGTATATCCGTCAGCGCCGTCTGACCGAGTCGGCCCTGACGCTGCTT
AACAGCAACGAAGCGATTTTACAGGTGGCGATGAGCTATGGGTTTGATACCCAACAGGCCTACACCCGAACGTTTAAAAA
CTATTTTATGGTCACGCCGGGTCAACTGCGCCGTCAGCGCCGGGTAGAGCCAGATCGTTTATTATTCCCTTATGCCATGG
CAAGTTAG

Protein sequence :
MCSLHICFNQENTMNQREFIRSLLEWIESNLGHDLHLDEVARRAGYSRWHLQRLFRQHTGFSLAEYIRQRRLTESALTLL
NSNEAILQVAMSYGFDTQQAYTRTFKNYFMVTPGQLRRQRRVEPDRLLFPYAMAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 9e-23 51
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 9e-23 51
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 4e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_005936345.1 multiple antibiotic resistance protein MarA CP000647.1.gene1624. Protein 2e-24 54
marA YP_005936345.1 multiple antibiotic resistance protein MarA CP001918.1.gene2033. Protein 1e-25 54
marA YP_005936345.1 multiple antibiotic resistance protein MarA NC_002695.1.917339.p Protein 3e-25 53
marA YP_005936345.1 multiple antibiotic resistance protein MarA BAC0560 Protein 3e-25 53
marA YP_005936345.1 multiple antibiotic resistance protein MarA CP000034.1.gene1596. Protein 3e-25 53
marA YP_005936345.1 multiple antibiotic resistance protein MarA CP001138.1.gene1637. Protein 9e-25 52
marA YP_005936345.1 multiple antibiotic resistance protein MarA NC_010558.1.6276025. Protein 4e-23 51
marA YP_005936345.1 multiple antibiotic resistance protein MarA CP001138.1.gene612.p Protein 3e-22 43
marA YP_005936345.1 multiple antibiotic resistance protein MarA CP001138.1.gene4488. Protein 1e-20 41
marA YP_005936345.1 multiple antibiotic resistance protein MarA CP001918.1.gene327.p Protein 2e-20 41
marA YP_005936345.1 multiple antibiotic resistance protein MarA CP000647.1.gene4499. Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_005936345.1 multiple antibiotic resistance protein MarA VFG1038 Protein 4e-23 51
marA YP_005936345.1 multiple antibiotic resistance protein MarA VFG0585 Protein 1e-20 41