Gene Information

Name : soxS (PAJ_3440)
Accession : YP_005936315.1
Strain : Pantoea ananatis AJ13355
Genome accession: NC_017531
Putative virulence/resistance : Resistance
Product : regulatory protein SoxS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4125724 - 4126149 bp
Length : 426 bp
Strand : -
Note : similar to Pantoea sp. At- 9b, transcriptional regulator, AraC family (NCBI: ZP_05731748.1) COG: transcription subcellular localization as predicted by Psort 2.0: cytoplasmic

DNA sequence :
ATGATACAAGAAGAGATCATTCATTCACTGACGCACTGGATTGACCAAAACCTGGATAAGAGCCTGTCAATTGACGAAGT
CGCCGCCAAATCAGGCTATTCGAAATGGCATCTGCAACGTATGTTCCGTAGCGTGACGAAACAGACGTTAGGTGGCTATA
TTCGCGAACGCCGCCTGACGCTGGCCGCTGAAGCGCTGCGACAAACTCAGCGGCCGGTGTTTGATATTGCGATGCAATAT
GGCTATGACTCGCAACAGACATTCTCACGCGTTTTTCGTCGCCAGTTTTCACAAACGCCCACGGCTTATCGCCACGCGAT
GCGCCGCCAGGCCATCCAGCATCCGCGTTTGATGCGCTTTGACTGCAGCGACACGATGACCAGCTTTACCCAGCGGACAA
CGGGAGAATGCTGTCCGGTTAGCTGA

Protein sequence :
MIQEEIIHSLTHWIDQNLDKSLSIDEVAAKSGYSKWHLQRMFRSVTKQTLGGYIRERRLTLAAEALRQTQRPVFDIAMQY
GYDSQQTFSRVFRRQFSQTPTAYRHAMRRQAIQHPRLMRFDCSDTMTSFTQRTTGECCPVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-33 66
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 2e-23 48
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 2e-23 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_005936315.1 regulatory protein SoxS CP000647.1.gene4499. Protein 8e-35 68
soxS YP_005936315.1 regulatory protein SoxS BAC0371 Protein 9e-34 67
soxS YP_005936315.1 regulatory protein SoxS NC_002695.1.914293.p Protein 9e-34 67
soxS YP_005936315.1 regulatory protein SoxS CP001918.1.gene327.p Protein 8e-35 67
soxS YP_005936315.1 regulatory protein SoxS CP000034.1.gene4505. Protein 2e-33 66
soxS YP_005936315.1 regulatory protein SoxS CP001138.1.gene4488. Protein 4e-34 66
soxS YP_005936315.1 regulatory protein SoxS CP001138.1.gene612.p Protein 4e-27 50
soxS YP_005936315.1 regulatory protein SoxS NC_010558.1.6276025. Protein 1e-23 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_005936315.1 regulatory protein SoxS VFG0585 Protein 4e-34 66
soxS YP_005936315.1 regulatory protein SoxS VFG1038 Protein 9e-24 48