Gene Information

Name : PPUBIRD1_2959 (PPUBIRD1_2959)
Accession : YP_005930776.1
Strain : Pseudomonas putida BIRD-1
Genome accession: NC_017530
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3316499 - 3317161 bp
Length : 663 bp
Strand : -
Note : -

DNA sequence :
ATGCGGCTGTTGCTGGTTGAGGATGACATCGCGCTGGGTGAAGGGATCTGCGACGGCTTGCGCCAGGAGGGGTACACCCT
CGACTGGTTGCGTGACGGTGTCGGTGGCTTGCATGCGCTGCAACACGAGACCTTCGACCTGCTGATCCTGGATCTTGGAT
TGCCCCGTATGGATGGCCTCGAGCTACTCAGGCGTTTACGCGCCGGCGGCGACAGCTTGCCGGTGCTGATCCTTACCGCG
CGGGATGCCCTCGATGATCGCATTGCCGGCCTGGATGCCGGTGCCGATGACTACCTGGTCAAGCCTTTCGACCTCAACGA
GCTCAAGGCACGCTTGCGCGCCTTGCTGCGGCGCAGCGTCGGGCGCGCCAAGGTGCTGATCGAGCATGCCGGGGTCAGTC
TGGATCCGACCACCCAGCAAGTGCAATACAACGGCGTCGAGGTTGTACTCACCCCCAAAGAGTATGTGCTGCTGCATGAG
TTGCTGGCACAGCCCGGCAAGGTATTCACACGTGAGCGCCTGACTCAACTGCTGTATGGCTGGGATGAAGAGCCGGAGAG
CAACACGCTGGAGGTAAACATCTACCACCTGCGCAAGAAGCTGTTCAACGGCCTGATTCGCACGGTGCGCGGCATTGGCT
ATCTGGTCGAGGTCAAGGCATGA

Protein sequence :
MRLLLVEDDIALGEGICDGLRQEGYTLDWLRDGVGGLHALQHETFDLLILDLGLPRMDGLELLRRLRAGGDSLPVLILTA
RDALDDRIAGLDAGADDYLVKPFDLNELKARLRALLRRSVGRAKVLIEHAGVSLDPTTQQVQYNGVEVVLTPKEYVLLHE
LLAQPGKVFTRERLTQLLYGWDEEPESNTLEVNIYHLRKKLFNGLIRTVRGIGYLVEVKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-30 46
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-24 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-23 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator BAC0487 Protein 4e-30 49
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator NC_002516.2.879194.p Protein 2e-24 45
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator BAC0197 Protein 7e-28 43
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 4e-21 41
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 4e-21 41
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 4e-21 41
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 4e-21 41
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 4e-21 41
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 4e-21 41
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 4e-21 41
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 4e-21 41
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator BAC0308 Protein 3e-26 41
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator Y16952.3.orf35.gene. Protein 6e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator VFG0473 Protein 3e-34 49
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator VFG0596 Protein 1e-24 43
PPUBIRD1_2959 YP_005930776.1 DNA-binding response regulator VFG1390 Protein 2e-29 43