Gene Information

Name : mmr (MTCTRI2_3128)
Accession : YP_005918153.1
Strain : Mycobacterium tuberculosis CTRI-2
Genome accession: NC_017524
Putative virulence/resistance : Resistance
Product : multidrugs-transport integral membrane protein MMR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3426844 - 3427167 bp
Length : 324 bp
Strand : +
Note : Mapped to H37Rv Rv3065

DNA sequence :
TTGATCTACCTATACCTCTTGTGCGCGATCTTCGCGGAAGTGGTGGCAACCAGCCTGCTCAAAAGCACGGAAGGGTTCAC
TCGGTTGTGGCCCACGGTGGGCTGTCTAGTGGGTTATGGCATCGCTTTCGCGCTGCTGGCCTTGTCGATCTCGCACGGCA
TGCAGACGGACGTCGCCTATGCGCTGTGGTCGGCAATCGGTACGGCCGCCATTGTGCTGGTCGCCGTACTGTTTCTCGGC
TCGCCGATATCTGTGATGAAGGTGGTTGGCGTCGGCCTGATTGTCGTCGGCGTGGTCACGTTGAACCTGGCGGGTGCCCA
TTGA

Protein sequence :
MIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAYALWSAIGTAAIVLVAVLFLG
SPISVMKVVGVGLIVVGVVTLNLAGAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-08 46
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-08 46
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-08 46
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-08 46
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-08 46
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-08 46
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-08 46
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-08 46
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-08 46
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-08 46
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-08 46
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-08 46
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-08 46
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-08 46
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-08 46
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-08 46
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-08 46
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-08 46
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-08 46
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-08 46
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-08 46
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-08 46
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-08 46
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-08 46
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-08 46
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-08 46
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-08 46
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-08 46
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-08 46
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-08 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mmr YP_005918153.1 multidrugs-transport integral membrane protein MMR BAC0249 Protein 2e-34 100
mmr YP_005918153.1 multidrugs-transport integral membrane protein MMR AE000516.2.gene3301. Protein 2e-34 100
mmr YP_005918153.1 multidrugs-transport integral membrane protein MMR BAC0322 Protein 4e-09 46
mmr YP_005918153.1 multidrugs-transport integral membrane protein MMR NC_002695.1.913273.p Protein 4e-11 46
mmr YP_005918153.1 multidrugs-transport integral membrane protein MMR BAC0150 Protein 3e-11 46
mmr YP_005918153.1 multidrugs-transport integral membrane protein MMR BAC0323 Protein 5e-09 46
mmr YP_005918153.1 multidrugs-transport integral membrane protein MMR BAC0329 Protein 3e-11 42
mmr YP_005918153.1 multidrugs-transport integral membrane protein MMR BAC0324 Protein 2e-09 41