Gene Information

Name : HP15_191 (HP15_191)
Accession : YP_005883883.1
Strain : Marinobacter adhaerens HP15
Genome accession: NC_017506
Putative virulence/resistance : Resistance
Product : Hg(II)--responsive transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 180614 - 181048 bp
Length : 435 bp
Strand : -
Note : -

DNA sequence :
ATGTTGGATAAAGCTAATTCACTGACTATTGGCGGCTTGGCCAGGGCGGCCAACGTAAATGTAGAGACGATCCGCTATTA
CCAGCGACGTGGTCTGTTATCGGAACCCAAGCGGCCTCCGGGTGGCATTCGACGCTACGGTTTCGCCGATATTGATCGGT
TGACCTTTGTGAAAACGGCGCAGCACCTGGGTTTCAGTCTCGATGAGATAAGCGACCTCCTACGGCTGGAAGATGGCACC
CACTGTGAGGAAGCCAGTGCGCTCGCCGAGCACAAGCTGAAGGATGTGCGTGAAAAGATCGAAAGGCTGGTCAAAATTGA
GATGGCTCTGAGCGATATGGTCAGTCAATGCCACGCACAGCCGGACAGCATCGCGTGCCCGCTCATTGCTTCGTTACATG
AGGGAGGTATTGGGACAAGAGGCCAAAAGGGTTAG

Protein sequence :
MLDKANSLTIGGLARAANVNVETIRYYQRRGLLSEPKRPPGGIRRYGFADIDRLTFVKTAQHLGFSLDEISDLLRLEDGT
HCEEASALAEHKLKDVREKIERLVKIEMALSDMVSQCHAQPDSIACPLIASLHEGGIGTRGQKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACK44535.1 MerR Not tested SGI1 Protein 4e-41 64
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 6e-41 64
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 4e-41 64
merR AFG30124.1 MerR Not tested PAGI-2 Protein 4e-41 64
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 4e-42 64
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 3e-42 64
merR AGK07025.1 MerR Not tested SGI1 Protein 2e-40 63
merR AGK07083.1 MerR Not tested SGI1 Protein 2e-40 63
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 8e-39 59
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 3e-37 58
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 1e-25 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HP15_191 YP_005883883.1 Hg(II)--responsive transcriptional regulator BAC0688 Protein 4e-42 67
HP15_191 YP_005883883.1 Hg(II)--responsive transcriptional regulator BAC0232 Protein 8e-42 65
HP15_191 YP_005883883.1 Hg(II)--responsive transcriptional regulator BAC0687 Protein 8e-42 65
HP15_191 YP_005883883.1 Hg(II)--responsive transcriptional regulator BAC0683 Protein 7e-42 64
HP15_191 YP_005883883.1 Hg(II)--responsive transcriptional regulator BAC0684 Protein 3e-42 64
HP15_191 YP_005883883.1 Hg(II)--responsive transcriptional regulator BAC0686 Protein 6e-41 63
HP15_191 YP_005883883.1 Hg(II)--responsive transcriptional regulator BAC0689 Protein 4e-40 60
HP15_191 YP_005883883.1 Hg(II)--responsive transcriptional regulator BAC0682 Protein 1e-20 42