Gene Information

Name : NMV_0429 (NMV_0429)
Accession : YP_005877960.1
Strain : Neisseria meningitidis 8013
Genome accession: NC_017501
Putative virulence/resistance : Resistance
Product : putative small multidrug resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 404480 - 404815 bp
Length : 336 bp
Strand : -
Note : 'Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pt : putative transporter'

DNA sequence :
ATGCAAATGCACTGGCTCTTTCTGACTGTAGCAATTTTAAGCGAAGTCTGCGGTTCTTCCATGCTCAAACTGAGTGGCGG
GTTTAGCAAACTGTGGCCTTCTATTGGCGTGGTAGTCAGCTTTTCGGTGTGTTTTTGGGCCTTGTCTATGACACTGAAAA
CCATGCCGCTGGCTACAGCATACGCCATTTGGGCAGGCGTGGGACTGGTTTTAACGGCTTTAGTCAGCGTGGTGTTTTTC
GGTGAGAAAGCTGATTTCATTGGGATTGTCAGCATCGGTTTGATTTTGCTGGGCGTGGTGCTTCTCAATACCATGTCGCA
TATGTCGGGGCATTGA

Protein sequence :
MQMHWLFLTVAILSEVCGSSMLKLSGGFSKLWPSIGVVVSFSVCFWALSMTLKTMPLATAYAIWAGVGLVLTALVSVVFF
GEKADFIGIVSIGLILLGVVLLNTMSHMSGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-11 44
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-11 44
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 44
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-11 44
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-11 44
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-11 44
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 44
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-11 44
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-11 44
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-11 44
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 44
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-11 44
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-11 44
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-11 44
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-11 44
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-11 44
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-11 44
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-11 44
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-11 44
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-11 44
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-11 44
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-11 44
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-11 44
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-11 44
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-11 44
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-11 44
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-11 44
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-11 44
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 44
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-11 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NMV_0429 YP_005877960.1 putative small multidrug resistance protein BAC0326 Protein 3e-17 54
NMV_0429 YP_005877960.1 putative small multidrug resistance protein BAC0327 Protein 1e-19 52
NMV_0429 YP_005877960.1 putative small multidrug resistance protein BAC0329 Protein 2e-16 52
NMV_0429 YP_005877960.1 putative small multidrug resistance protein BAC0325 Protein 4e-19 51
NMV_0429 YP_005877960.1 putative small multidrug resistance protein BAC0321 Protein 2e-17 50
NMV_0429 YP_005877960.1 putative small multidrug resistance protein BAC0139 Protein 6e-11 50
NMV_0429 YP_005877960.1 putative small multidrug resistance protein BAC0377 Protein 5e-18 49
NMV_0429 YP_005877960.1 putative small multidrug resistance protein BAC0150 Protein 4e-16 48
NMV_0429 YP_005877960.1 putative small multidrug resistance protein NC_002695.1.913273.p Protein 5e-16 48
NMV_0429 YP_005877960.1 putative small multidrug resistance protein CP004022.1.gene1549. Protein 5e-16 47
NMV_0429 YP_005877960.1 putative small multidrug resistance protein BAC0324 Protein 2e-14 47
NMV_0429 YP_005877960.1 putative small multidrug resistance protein BAC0002 Protein 6e-12 45
NMV_0429 YP_005877960.1 putative small multidrug resistance protein NC_010410.6003348.p0 Protein 6e-12 45
NMV_0429 YP_005877960.1 putative small multidrug resistance protein BAC0322 Protein 1e-12 44
NMV_0429 YP_005877960.1 putative small multidrug resistance protein BAC0323 Protein 6e-12 44
NMV_0429 YP_005877960.1 putative small multidrug resistance protein CP001138.1.gene1489. Protein 6e-13 43