Gene Information

Name : LCGL_0429 (LCGL_0429)
Accession : YP_005870173.1
Strain : Lactococcus garvieae Lg2
Genome accession: NC_017490
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 445231 - 445926 bp
Length : 696 bp
Strand : +
Note : -

DNA sequence : 
ATGAATTCATCTAAACGTATTTTGATTATCGAAGACGATAAAAACATTGCGAGATTTGTTTCACTTGAGCTTGAACACGA
AGGATACCAAACTGCGGTTCAAGGCAATGGTCGTAAAGGTCTTGAAGAAGCAATGTCAAAAGATTATGATTTGATTTTGC
TTGACTTAATGCTCCCAGAGCTTGATGGCTTTGAGGTTGCACGACGCTTACGCCGTGAGAAAGATACACATATTATTATG
ATGACTGCACGTGATTCGACAATGGACCGTGTAGCAGGGCTTGATATTGGCGCAGATGACTATATTACAAAACCATTTGC
TATTGAAGAATTGTTAGCGCGTGTCCGCTCACTCTTCCGTCGTGAAGATCATATCCACACGATTGAAAAGTCAGACAATA
CTTCATTCCGTGATTTGGTAATTGATAAGACCAACCGTACTGTACACCGTGGAAAAAAAGTTATTGACCTTACACGCCGT
GAGTACGATTTGCTTTTGACACTGATGCAAAATGTAGGTGATGTCGTAACACGTGAATACTTGGTTTCTGAAGTATGGGG
TTACGAAGAAGGTACAGAAACAAACGTTGTGGACGTTTATATCCGTTATCTGCGTAACAAAATTGACGTGGAGGGCCGTG
AAAGCTATATCCAAACGGTTCGTGGTATGGGATATGTCATGCGTGACCGCAAATAA

Protein sequence : 
MNSSKRILIIEDDKNIARFVSLELEHEGYQTAVQGNGRKGLEEAMSKDYDLILLDLMLPELDGFEVARRLRREKDTHIIM
MTARDSTMDRVAGLDIGADDYITKPFAIEELLARVRSLFRREDHIHTIEKSDNTSFRDLVIDKTNRTVHRGKKVIDLTRR
EYDLLLTLMQNVGDVVTREYLVSEVWGYEEGTETNVVDVYIRYLRNKIDVEGRESYIQTVRGMGYVMRDRK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-31 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-30 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LCGL_0429 YP_005870173.1 two-component response regulator HE999704.1.gene1528. Protein 2e-55 64
LCGL_0429 YP_005870173.1 two-component response regulator NC_013450.8614146.p0 Protein 4e-43 51
LCGL_0429 YP_005870173.1 two-component response regulator NC_002951.3238224.p0 Protein 4e-43 51
LCGL_0429 YP_005870173.1 two-component response regulator NC_007793.3914065.p0 Protein 4e-43 51
LCGL_0429 YP_005870173.1 two-component response regulator NC_002758.1121390.p0 Protein 4e-43 51
LCGL_0429 YP_005870173.1 two-component response regulator NC_010079.5776364.p0 Protein 4e-43 51
LCGL_0429 YP_005870173.1 two-component response regulator NC_002952.2859858.p0 Protein 4e-43 51
LCGL_0429 YP_005870173.1 two-component response regulator NC_007622.3794948.p0 Protein 4e-43 51
LCGL_0429 YP_005870173.1 two-component response regulator NC_003923.1003417.p0 Protein 4e-43 51
LCGL_0429 YP_005870173.1 two-component response regulator AE015929.1.gene1106. Protein 1e-40 50
LCGL_0429 YP_005870173.1 two-component response regulator BAC0125 Protein 5e-30 44
LCGL_0429 YP_005870173.1 two-component response regulator BAC0308 Protein 6e-32 44
LCGL_0429 YP_005870173.1 two-component response regulator BAC0197 Protein 2e-30 44
LCGL_0429 YP_005870173.1 two-component response regulator NC_012469.1.7685629. Protein 1e-34 42
LCGL_0429 YP_005870173.1 two-component response regulator AE016830.1.gene1681. Protein 7e-35 41
LCGL_0429 YP_005870173.1 two-component response regulator AF155139.2.orf0.gene Protein 6e-26 41
LCGL_0429 YP_005870173.1 two-component response regulator BAC0638 Protein 1e-25 41
LCGL_0429 YP_005870173.1 two-component response regulator AE000516.2.gene3505. Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LCGL_0429 YP_005870173.1 two-component response regulator VFG1390 Protein 3e-38 45
LCGL_0429 YP_005870173.1 two-component response regulator VFG0596 Protein 2e-31 45
LCGL_0429 YP_005870173.1 two-component response regulator VFG1389 Protein 4e-31 41