Gene Information

Name : LCGL_0271 (LCGL_0271)
Accession : YP_005870015.1
Strain : Lactococcus garvieae Lg2
Genome accession: NC_017490
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 276395 - 277096 bp
Length : 702 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAAAATTCTTGTTGTTGACGACGAAAAACCAATTTCTGATATTGTAAAATTTAACCTCGTCAAAGAAGGGTATGA
AGTAGTCACTGCTTTTGATGGTGAAGAAGCTCTTGAACTCTTTGAATCAGAAAAACCCGATCTTATCTATCTTGATTTGA
TGCTTCCAAAAATTGATGGTCTTGAAGTTACACGTCAAATTCGTAAAACTTCTGAAGTCCCTATTTTGATGGTTTCTGCC
AAAGATACAGAGTTTGATAAAGTTATCGGCCTTGAACTCGGTGCAGATGATTACATCACAAAACCATTTTCAAACCGTGA
ATTACTTGCTCGTATTAAATCAAATTTACGCCGCATGACAAATGTTCCTGTTGAACAACCAAAAGATTCTAAAAAAGAAT
TGGTAATTGGTAACTTACGTATCAACCCGACACATTATGCCGCATATAAAAATGAGACACAACTTGACTTGACACACCGC
GAATTTGAATTGCTCTATTATCTTGCACAACATCTCGGTGAAGTTATCACACGTGAAACATTGCTTGAAACTGTTTGGGG
CTATGATTACTTCGGTGATGTTCGTACTGTTGACGTCACAGTTCGTCGTCTTCGCGAAAAAGTTGAAGATACTCCAAGCC
GCCCTCAATACGTATCTACACGTCGTGGTGTTGGATACTATATGAGCGAACCTCATGAATAA

Protein sequence :
MKKILVVDDEKPISDIVKFNLVKEGYEVVTAFDGEEALELFESEKPDLIYLDLMLPKIDGLEVTRQIRKTSEVPILMVSA
KDTEFDKVIGLELGADDYITKPFSNRELLARIKSNLRRMTNVPVEQPKDSKKELVIGNLRINPTHYAAYKNETQLDLTHR
EFELLYYLAQHLGEVITRETLLETVWGYDYFGDVRTVDVTVRRLREKVEDTPSRPQYVSTRRGVGYYMSEPHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-34 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-33 42
nisR2 YP_006309922.1 NisR Not tested FWisland_1 Protein 5e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LCGL_0271 YP_005870015.1 two-component response regulator NC_012469.1.7685629. Protein 1e-72 75
LCGL_0271 YP_005870015.1 two-component response regulator HE999704.1.gene2815. Protein 2e-50 55
LCGL_0271 YP_005870015.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-54 54
LCGL_0271 YP_005870015.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-54 54
LCGL_0271 YP_005870015.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-54 54
LCGL_0271 YP_005870015.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-54 54
LCGL_0271 YP_005870015.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-54 54
LCGL_0271 YP_005870015.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-54 54
LCGL_0271 YP_005870015.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-54 54
LCGL_0271 YP_005870015.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-54 54
LCGL_0271 YP_005870015.1 two-component response regulator NC_002952.2859905.p0 Protein 3e-54 53
LCGL_0271 YP_005870015.1 two-component response regulator NC_007622.3794472.p0 Protein 3e-54 53
LCGL_0271 YP_005870015.1 two-component response regulator AE016830.1.gene1681. Protein 4e-47 49
LCGL_0271 YP_005870015.1 two-component response regulator NC_012469.1.7686381. Protein 7e-44 49
LCGL_0271 YP_005870015.1 two-component response regulator CP001918.1.gene5135. Protein 3e-27 46
LCGL_0271 YP_005870015.1 two-component response regulator AF162694.1.orf4.gene Protein 3e-34 44
LCGL_0271 YP_005870015.1 two-component response regulator AE000516.2.gene3505. Protein 5e-31 44
LCGL_0271 YP_005870015.1 two-component response regulator NC_002695.1.915041.p Protein 5e-31 44
LCGL_0271 YP_005870015.1 two-component response regulator CP001138.1.gene4273. Protein 3e-31 44
LCGL_0271 YP_005870015.1 two-component response regulator CP000034.1.gene3834. Protein 5e-31 44
LCGL_0271 YP_005870015.1 two-component response regulator CP004022.1.gene3215. Protein 3e-35 44
LCGL_0271 YP_005870015.1 two-component response regulator AM180355.1.gene1830. Protein 2e-33 43
LCGL_0271 YP_005870015.1 two-component response regulator FJ349556.1.orf0.gene Protein 1e-40 43
LCGL_0271 YP_005870015.1 two-component response regulator AE015929.1.gene1106. Protein 3e-29 43
LCGL_0271 YP_005870015.1 two-component response regulator CP000647.1.gene4257. Protein 4e-31 43
LCGL_0271 YP_005870015.1 two-component response regulator BAC0533 Protein 4e-31 43
LCGL_0271 YP_005870015.1 two-component response regulator NC_014475.1.orf0.gen Protein 5e-36 42
LCGL_0271 YP_005870015.1 two-component response regulator NC_005054.2598277.p0 Protein 5e-36 42
LCGL_0271 YP_005870015.1 two-component response regulator HE999704.1.gene1528. Protein 3e-30 41
LCGL_0271 YP_005870015.1 two-component response regulator DQ212986.1.gene4.p01 Protein 2e-32 41
LCGL_0271 YP_005870015.1 two-component response regulator AF155139.2.orf0.gene Protein 1e-37 41
LCGL_0271 YP_005870015.1 two-component response regulator NC_007793.3914065.p0 Protein 6e-34 41
LCGL_0271 YP_005870015.1 two-component response regulator NC_002758.1121390.p0 Protein 6e-34 41
LCGL_0271 YP_005870015.1 two-component response regulator NC_010079.5776364.p0 Protein 6e-34 41
LCGL_0271 YP_005870015.1 two-component response regulator NC_002952.2859858.p0 Protein 6e-34 41
LCGL_0271 YP_005870015.1 two-component response regulator NC_007622.3794948.p0 Protein 6e-34 41
LCGL_0271 YP_005870015.1 two-component response regulator NC_003923.1003417.p0 Protein 6e-34 41
LCGL_0271 YP_005870015.1 two-component response regulator NC_013450.8614146.p0 Protein 6e-34 41
LCGL_0271 YP_005870015.1 two-component response regulator NC_002951.3238224.p0 Protein 6e-34 41
LCGL_0271 YP_005870015.1 two-component response regulator BAC0596 Protein 1e-26 41
LCGL_0271 YP_005870015.1 two-component response regulator CP000034.1.gene2186. Protein 3e-27 41
LCGL_0271 YP_005870015.1 two-component response regulator NC_002695.1.916589.p Protein 2e-27 41
LCGL_0271 YP_005870015.1 two-component response regulator CP001138.1.gene2239. Protein 1e-26 41
LCGL_0271 YP_005870015.1 two-component response regulator BAC0039 Protein 3e-27 41
LCGL_0271 YP_005870015.1 two-component response regulator CP000647.1.gene2531. Protein 2e-27 41
LCGL_0271 YP_005870015.1 two-component response regulator CP001918.1.gene3444. Protein 2e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LCGL_0271 YP_005870015.1 two-component response regulator VFG1563 Protein 2e-34 42
LCGL_0271 YP_005870015.1 two-component response regulator VFG1702 Protein 6e-34 42
LCGL_0271 YP_005870015.1 two-component response regulator VFG1389 Protein 8e-27 42