Gene Information

Name : tcsR5 (CVCAS_1502)
Accession : YP_005868865.1
Strain : Lactococcus lactis CV56
Genome accession: NC_017486
Putative virulence/resistance : Virulence
Product : two-component system regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1567319 - 1568011 bp
Length : 693 bp
Strand : -
Note : -

DNA sequence :
ATGACTTCAAAGAAAATTTTGATTATTGAGGATGAAAAGAATTTAGCGCGATTCGTCTCATTAGAATTAGAACATGAAGG
CTATGCGACTGAGATTAAAGATAATGGTCGTTCTGGTCTTGAAGAAGCAACTTCAAAAGATTATGATTTAATCTTGCTTG
ATTTGATGCTTCCTGAACTTGACGGTTTTGAGGTAGCCCGTCGTTTACGAAAAGAAAAAGATACACCAATCATTATGATG
ACGGCACGTGATTCAACGATGGACCGTGTTGCTGGTCTTGATATTGGGGCTGATGATTATATCACTAAACCTTTTGCGAT
TGAGGAACTTTTGGCGCGTGTTCGTGCTTTCTTCCGTCGTGAAGAGCATGGTCATGCCGTTGAACGTGCTGAAAATACTT
CTTTCCGTGATCTTGTGATTGACAAAACGAATCGCACAGTTCATCGTGGTAAAAAAGTAATTGATTTAACACGTCGTGAG
TATGACCTCCTTTTGACATTGATGCAAAATGTTGGCGATGTTGTGACTCGTGAACATTTAGTTTCACAAGTTTGGGGATA
TGAAGAAGGAACAGAAACAAATGTTGTGGATGTTTATATTCGTTATCTTAGAAATAAAATTGATGTTGAAGGTCAAGATA
GCTATATTCAAACTGTTCGTGGCTTAGGTTATGTAATGCGTGAACGCAAATAA

Protein sequence :
MTSKKILIIEDEKNLARFVSLELEHEGYATEIKDNGRSGLEEATSKDYDLILLDLMLPELDGFEVARRLRKEKDTPIIMM
TARDSTMDRVAGLDIGADDYITKPFAIEELLARVRAFFRREEHGHAVERAENTSFRDLVIDKTNRTVHRGKKVIDLTRRE
YDLLLTLMQNVGDVVTREHLVSQVWGYEEGTETNVVDVYIRYLRNKIDVEGQDSYIQTVRGLGYVMRERK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-31 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-31 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tcsR5 YP_005868865.1 two-component system regulator HE999704.1.gene1528. Protein 2e-56 63
tcsR5 YP_005868865.1 two-component system regulator NC_002758.1121390.p0 Protein 1e-44 52
tcsR5 YP_005868865.1 two-component system regulator NC_010079.5776364.p0 Protein 1e-44 52
tcsR5 YP_005868865.1 two-component system regulator NC_002952.2859858.p0 Protein 1e-44 52
tcsR5 YP_005868865.1 two-component system regulator NC_007622.3794948.p0 Protein 1e-44 52
tcsR5 YP_005868865.1 two-component system regulator NC_003923.1003417.p0 Protein 1e-44 52
tcsR5 YP_005868865.1 two-component system regulator NC_013450.8614146.p0 Protein 1e-44 52
tcsR5 YP_005868865.1 two-component system regulator NC_002951.3238224.p0 Protein 1e-44 52
tcsR5 YP_005868865.1 two-component system regulator NC_007793.3914065.p0 Protein 1e-44 52
tcsR5 YP_005868865.1 two-component system regulator AE015929.1.gene1106. Protein 4e-42 52
tcsR5 YP_005868865.1 two-component system regulator BAC0308 Protein 1e-32 44
tcsR5 YP_005868865.1 two-component system regulator BAC0125 Protein 1e-31 44
tcsR5 YP_005868865.1 two-component system regulator NC_012469.1.7685629. Protein 7e-35 44
tcsR5 YP_005868865.1 two-component system regulator BAC0197 Protein 4e-32 43
tcsR5 YP_005868865.1 two-component system regulator AE016830.1.gene1681. Protein 2e-34 42
tcsR5 YP_005868865.1 two-component system regulator BAC0111 Protein 3e-31 42
tcsR5 YP_005868865.1 two-component system regulator NC_012469.1.7686381. Protein 1e-34 41
tcsR5 YP_005868865.1 two-component system regulator BAC0083 Protein 2e-31 41
tcsR5 YP_005868865.1 two-component system regulator HE999704.1.gene2815. Protein 1e-33 41
tcsR5 YP_005868865.1 two-component system regulator BAC0638 Protein 1e-25 41
tcsR5 YP_005868865.1 two-component system regulator AE000516.2.gene3505. Protein 3e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tcsR5 YP_005868865.1 two-component system regulator VFG0596 Protein 1e-31 46
tcsR5 YP_005868865.1 two-component system regulator VFG1390 Protein 5e-41 45
tcsR5 YP_005868865.1 two-component system regulator VFG1389 Protein 2e-32 41